Q969H4 · CNKR1_HUMAN
- ProteinConnector enhancer of kinase suppressor of ras 1
- GeneCNKSR1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids720 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell cortex | |
Cellular Component | cell-cell junction | |
Cellular Component | plasma membrane | |
Molecular Function | protein-macromolecule adaptor activity | |
Biological Process | cell surface receptor protein tyrosine kinase signaling pathway |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameConnector enhancer of kinase suppressor of ras 1
- Short namesConnector enhancer of KSR 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ969H4
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 493 | No interaction with Rho. | ||||
Sequence: W → A | ||||||
Natural variant | VAR_057790 | 662 | in dbSNP:rs17163640 | |||
Sequence: R → W |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 855 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000089969 | 1-720 | UniProt | Connector enhancer of kinase suppressor of ras 1 | |||
Sequence: MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGLEIHTTSNCQHFVSQVDTQVPTDSRLQIQPGDEVVQINEQVVVREERDMVGWPRKNMVRELLREPAGLSLVLKKIPIPETPPQTPPQVLDSPHQRSPSLSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPLPIPPEPPAILPAGVAGTPGLPESPDKSPVGRKKSKGLATRLSRRRVSCRELGRPDCDGWLLLRKAPGGFMGPRWRRRWFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTLTDLSMWVRHLITCISKYQSPGRAPPPREEDCYSETEAEDPDDEAGSHSASPSPAQAGSPLHGDTSPAATPTQRSPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQNRELYSEGLGAWGVAQAEGSSHILTSDSTEQSPHSLPSDPEEHSHLCPLTSESSLRPPDL | |||||||
Modified residue (large scale data) | 289 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 293 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 300 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 305 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 307 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 307 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 314 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 314 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q969H4 | CYTH1 Q15438 | 6 | EBI-741671, EBI-997830 | |
BINARY | Q969H4 | CYTH2 Q99418 | 4 | EBI-741671, EBI-448974 | |
BINARY | Q969H4 | CYTH3 O43739 | 5 | EBI-741671, EBI-741648 | |
BINARY | Q969H4 | CYTH3 O43739-2 | 4 | EBI-741671, EBI-11974015 | |
BINARY | Q969H4 | CYTH4 Q8WWE8 | 3 | EBI-741671, EBI-10277443 | |
BINARY | Q969H4 | CYTH4 Q9UIA0 | 4 | EBI-741671, EBI-11521003 | |
BINARY | Q969H4 | PIN1 Q13526 | 6 | EBI-741671, EBI-714158 | |
BINARY | Q969H4 | TCAF1 Q9Y4C2-2 | 3 | EBI-741671, EBI-11974855 | |
BINARY | Q969H4 | ZGPAT Q8N5A5-2 | 3 | EBI-741671, EBI-10183064 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-70 | SAM | ||||
Sequence: WTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQAL | ||||||
Domain | 78-164 | CRIC | ||||
Sequence: NLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAA | ||||||
Domain | 196-285 | PDZ | ||||
Sequence: KAVLEQVQLDSPLGLEIHTTSNCQHFVSQVDTQVPTDSRLQIQPGDEVVQINEQVVVREERDMVGWPRKNMVRELLREPAGLSLVLKKIP | ||||||
Region | 285-390 | Disordered | ||||
Sequence: PIPETPPQTPPQVLDSPHQRSPSLSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPLPIPPEPPAILPAGVAGTPGLPESPDKSPVGRKKSKGLATR | ||||||
Compositional bias | 298-312 | Polar residues | ||||
Sequence: LDSPHQRSPSLSLAP | ||||||
Compositional bias | 325-339 | Polar residues | ||||
Sequence: FDLSSNPSPGPSPAW | ||||||
Compositional bias | 347-361 | Pro residues | ||||
Sequence: PEPLPIPPEPPAILP | ||||||
Domain | 403-502 | PH | ||||
Sequence: RPDCDGWLLLRKAPGGFMGPRWRRRWFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTLTDLSMWVRHLITCIS | ||||||
Region | 504-573 | Disordered | ||||
Sequence: YQSPGRAPPPREEDCYSETEAEDPDDEAGSHSASPSPAQAGSPLHGDTSPAATPTQRSPRTSFGSLTDSS | ||||||
Compositional bias | 535-572 | Polar residues | ||||
Sequence: SASPSPAQAGSPLHGDTSPAATPTQRSPRTSFGSLTDS | ||||||
Coiled coil | 615-646 | |||||
Sequence: QLNERVHRVRALQSTLKAKLQELQVLEEVLGD | ||||||
Region | 676-720 | Disordered | ||||
Sequence: QAEGSSHILTSDSTEQSPHSLPSDPEEHSHLCPLTSESSLRPPDL | ||||||
Compositional bias | 679-695 | Polar residues | ||||
Sequence: GSSHILTSDSTEQSPHS |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q969H4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length720
- Mass (Da)79,706
- Last updated2001-12-01 v1
- ChecksumE090785D1486D84B
Q969H4-2
- Name2
- Differences from canonical
- 253-259: Missing
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_010886 | 253-259 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 298-312 | Polar residues | ||||
Sequence: LDSPHQRSPSLSLAP | ||||||
Compositional bias | 325-339 | Polar residues | ||||
Sequence: FDLSSNPSPGPSPAW | ||||||
Compositional bias | 347-361 | Pro residues | ||||
Sequence: PEPLPIPPEPPAILP | ||||||
Compositional bias | 535-572 | Polar residues | ||||
Sequence: SASPSPAQAGSPLHGDTSPAATPTQRSPRTSFGSLTDS | ||||||
Compositional bias | 679-695 | Polar residues | ||||
Sequence: GSSHILTSDSTEQSPHS | ||||||
Sequence conflict | 694 | in Ref. 1; AAC80558 | ||||
Sequence: H → N |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF100153 EMBL· GenBank· DDBJ | AAC80558.1 EMBL· GenBank· DDBJ | mRNA | ||
BT006900 EMBL· GenBank· DDBJ | AAP35546.1 EMBL· GenBank· DDBJ | mRNA | ||
AL355877 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL391650 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471059 EMBL· GenBank· DDBJ | EAX07842.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC011604 EMBL· GenBank· DDBJ | AAH11604.1 EMBL· GenBank· DDBJ | mRNA | ||
BC012797 EMBL· GenBank· DDBJ | AAH12797.1 EMBL· GenBank· DDBJ | mRNA |