Q969G5 · CAVN3_HUMAN
- ProteinCaveolae-associated protein 3
- GeneCAVIN3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids261 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulates the traffic and/or budding of caveolae (PubMed:19262564).
Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in smooth muscle but not in the lung and heart endothelial cells. Regulates the equilibrium between cell surface-associated and cell surface-dissociated caveolae by promoting the rapid release of caveolae from the cell surface. Plays a role in the regulation of the circadian clock. Modulates the period length and phase of circadian gene expression and also regulates expression and interaction of the core clock components PER1/2 and CRY1/2 (By similarity).
Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in smooth muscle but not in the lung and heart endothelial cells. Regulates the equilibrium between cell surface-associated and cell surface-dissociated caveolae by promoting the rapid release of caveolae from the cell surface. Plays a role in the regulation of the circadian clock. Modulates the period length and phase of circadian gene expression and also regulates expression and interaction of the core clock components PER1/2 and CRY1/2 (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | caveola | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | protein-containing complex | |
Molecular Function | protein kinase C binding | |
Biological Process | circadian regulation of gene expression | |
Biological Process | cortical actin cytoskeleton organization | |
Biological Process | negative regulation of fermentation | |
Biological Process | negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction | |
Biological Process | positive regulation of ERK1 and ERK2 cascade |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCaveolae-associated protein 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ969G5
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes in the caveolae in a caveolin-dependent manner.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_042851 | 8 | in dbSNP:rs2682123 | |||
Sequence: R → P | ||||||
Natural variant | VAR_042852 | 104 | in dbSNP:rs10839551 | |||
Sequence: A → T | ||||||
Natural variant | VAR_042853 | 158 | in dbSNP:rs1051992 | |||
Sequence: L → P | ||||||
Natural variant | VAR_042854 | 255 | in dbSNP:rs12294600 | |||
Sequence: L → F |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 385 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue, cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000331412 | 1-261 | UniProt | Caveolae-associated protein 3 | |||
Sequence: MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA | |||||||
Modified residue (large scale data) | 56 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 62 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 62 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 70 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 128 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 165 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 165 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 166 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 166 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 173 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 205 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
In vitro, phosphorylated by PRKCD.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Strongly expressed in mammary and epithelial cells.
Induction
Down-regulated in breast and lung cancer cell lines.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the CAVIN complex composed of CAVIN1, CAVIN2, CAVIN3 and CAVIN4. Interacts with PRKCD and with phosphatidylserine. Phosphatidylserine may form a bridge between PKC and PKC-binding partners and stabilize the binding. Interacts with PER2. Interacts with CAVIN1 (By similarity).
Interacts (via leucine-zipper domain) with CAV1 in a cholesterol-sensitive manner (PubMed:19262564).
Interacts with EPS15L1 (PubMed:19262564).
Interacts (via leucine-zipper domain) with CAV1 in a cholesterol-sensitive manner (PubMed:19262564).
Interacts with EPS15L1 (PubMed:19262564).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q969G5 | CAV1 Q03135 | 11 | EBI-3893101, EBI-603614 | |
BINARY | Q969G5 | CAVIN1 Q6NZI2 | 12 | EBI-3893101, EBI-2559016 | |
BINARY | Q969G5 | CEP70 Q8NHQ1 | 3 | EBI-3893101, EBI-739624 | |
BINARY | Q969G5 | CEP76 Q8TAP6 | 3 | EBI-3893101, EBI-742887 | |
BINARY | Q969G5 | EPS15L1 Q9UBC2 | 2 | EBI-3893101, EBI-2556746 | |
BINARY | Q969G5 | GOLGA6L9 A6NEM1 | 3 | EBI-3893101, EBI-5916454 | |
BINARY | Q969G5 | GPRASP2 Q96D09 | 3 | EBI-3893101, EBI-473189 | |
BINARY | Q969G5 | MAGEA11 P43364 | 3 | EBI-3893101, EBI-739552 | |
BINARY | Q969G5 | MRFAP1 Q9Y605 | 6 | EBI-3893101, EBI-995714 | |
BINARY | Q969G5 | MRFAP1L1 Q96HT8 | 7 | EBI-3893101, EBI-748896 | |
BINARY | Q969G5 | NUP62 P37198 | 3 | EBI-3893101, EBI-347978 | |
BINARY | Q969G5 | TFIP11 Q9UBB9 | 3 | EBI-3893101, EBI-1105213 | |
BINARY | Q969G5 | TIMM8A O60220 | 3 | EBI-3893101, EBI-1049822 | |
BINARY | Q969G5 | TPM3 P06753 | 4 | EBI-3893101, EBI-355607 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-84 | Interaction with CAVIN1 | ||||
Sequence: MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTSNTLAQLLAK | ||||||
Region | 20-78 | Leucine-zipper | ||||
Sequence: VHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTSNTL | ||||||
Region | 135-203 | Interaction with CAV1 | ||||
Sequence: ASAFQKAPEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPP | ||||||
Region | 139-261 | Disordered | ||||
Sequence: QKAPEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA |
Domain
The leucine-zipper domain is essential for its localization in the caveolae and for its interaction with CAV1 and EPS15L1.
Sequence similarities
Belongs to the CAVIN family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length261
- Mass (Da)27,701
- Last updated2011-01-11 v3
- ChecksumE806A01DA992C53B
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E9PIE3 | E9PIE3_HUMAN | CAVIN3 | 293 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF339881 EMBL· GenBank· DDBJ | AAK97572.1 EMBL· GenBank· DDBJ | mRNA | ||
AF408198 EMBL· GenBank· DDBJ | AAK97528.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC068733 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471064 EMBL· GenBank· DDBJ | EAW68733.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC011585 EMBL· GenBank· DDBJ | AAH11585.1 EMBL· GenBank· DDBJ | mRNA |