Q969B0 · KIN13_GIAIN
- ProteinKinesin-like protein KIN-13
- Genekin-13
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids439 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in cell cycle (PubMed:35772734).
Involved in formation of flagella, regulation of flagellar length, and formation of median bodies during interphase (PubMed:35772734).
Regulates flagellar length in all eight distal flagellar tips by promoting disassembly of the microtubules (By similarity).
Disassembles microtubules at the distal flagellar tips in a length-dependent manner in order to maintain different equilibrium lengths of the four flagellar pairs (By similarity).
Regulates interphase and mitotic microtubule dynamics (By similarity).
Regulates microtubule disassembly dynamics of the dual mitotic spindles and the median body (By similarity).
Involved in formation of flagella, regulation of flagellar length, and formation of median bodies during interphase (PubMed:35772734).
Regulates flagellar length in all eight distal flagellar tips by promoting disassembly of the microtubules (By similarity).
Disassembles microtubules at the distal flagellar tips in a length-dependent manner in order to maintain different equilibrium lengths of the four flagellar pairs (By similarity).
Regulates interphase and mitotic microtubule dynamics (By similarity).
Regulates microtubule disassembly dynamics of the dual mitotic spindles and the median body (By similarity).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 9+2 motile cilium | |
Cellular Component | axoneme | |
Cellular Component | ciliary basal body | |
Cellular Component | ciliary tip | |
Cellular Component | kinetochore | |
Cellular Component | median body | |
Cellular Component | microtubule | |
Cellular Component | spindle | |
Cellular Component | ventral disc | |
Molecular Function | ATP binding | |
Molecular Function | microtubule binding | |
Molecular Function | microtubule motor activity | |
Biological Process | axonemal microtubule depolymerization | |
Biological Process | cell division | |
Biological Process | microtubule-based movement | |
Biological Process | mitotic cell cycle | |
Biological Process | mitotic spindle microtubule depolymerization | |
Biological Process | negative regulation of cilium assembly | |
Biological Process | plus-end specific microtubule depolymerization |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameKinesin-like protein KIN-13
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metamonada > Diplomonadida > Hexamitidae > Giardiinae > Giardia
Accessions
- Primary accessionQ969B0
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes and accumulates in a length-dependent manner to the distal regions of flagellar tips (By similarity).
Amount at the distal flagellar tip increases during de novo assembly possibly as a consequence of its transport along the flagellum (By similarity).
More of it is present in the caudal flagellar tips than in the longer anterior flagellar tips (By similarity).
Amount decreases sharply immediately proximal to the flagellar tip indicating that it does not undergo directed retrograde transport on the axoneme, but likely diffuses from the flagella tip toward the base (By similarity).
During diffusion, it may be recaptured by anterograde intraflagellar transport (IFT) trains to sequester it to the tip region (By similarity).
Localizes to basal bodies, to microtubule (MT)-containing structures such as the median body and axonemes, and to the tips of all eight flagella in interphase (PubMed:35772734).
Localizes uniformly to the median body and unevenly at distinct regions of all eight flagella, primarily localizing to the distal flagellar tips, in interphase (By similarity).
Localizes to the cytoplasmic axonemes in interphase (By similarity).
Localizes to the ventral disk in interphase (By similarity).
Localizes to the plus ends of interphase and mitotic microtubules (By similarity).
Localizes to single spots on chromosomes during mitosis (By similarity).
Localizes to the plus ends of microtubules and kinetochores in anaphase spindles (By similarity).
Localizes to the growing flagellar tips of the posterolateral and ventral axonemes during mitotic telophase (By similarity).
Localizes also to kinetochores during flagellar duplication (By similarity).
Amount at the distal flagellar tip increases during de novo assembly possibly as a consequence of its transport along the flagellum (By similarity).
More of it is present in the caudal flagellar tips than in the longer anterior flagellar tips (By similarity).
Amount decreases sharply immediately proximal to the flagellar tip indicating that it does not undergo directed retrograde transport on the axoneme, but likely diffuses from the flagella tip toward the base (By similarity).
During diffusion, it may be recaptured by anterograde intraflagellar transport (IFT) trains to sequester it to the tip region (By similarity).
Localizes to basal bodies, to microtubule (MT)-containing structures such as the median body and axonemes, and to the tips of all eight flagella in interphase (PubMed:35772734).
Localizes uniformly to the median body and unevenly at distinct regions of all eight flagella, primarily localizing to the distal flagellar tips, in interphase (By similarity).
Localizes to the cytoplasmic axonemes in interphase (By similarity).
Localizes to the ventral disk in interphase (By similarity).
Localizes to the plus ends of interphase and mitotic microtubules (By similarity).
Localizes to single spots on chromosomes during mitosis (By similarity).
Localizes to the plus ends of microtubules and kinetochores in anaphase spindles (By similarity).
Localizes to the growing flagellar tips of the posterolateral and ventral axonemes during mitotic telophase (By similarity).
Localizes also to kinetochores during flagellar duplication (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Simultaneous morpholino knockdown of both KIN-13 and PLK in interphase cells results in increased length of the caudal and anterior flagella, and to a lesser extent ventral flagella, and reduced volume of the median body.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000459164 | 1-439 | Kinesin-like protein KIN-13 | |||
Sequence: GSGKSFTMMHKDNGIYVLACFDILEYLRVYNGSQGNNSKFLVPVVSFFEIYGGKLFDLLNNRQRLQALEDGKGNVQITGLTEKQISSVDAMLNLIDSGLTLRAVGATGANADSSRSHAILQIALKYTKSGKEYSRISFIDLAGSERASDVQNSDRQTRMEGAEINKSLLALKECIRAMDKSNDSKSGAHIPFRGSKLTMVLRDSFIGNSQTVMIANISPNDKSCDNTLNTLRYADRVKELQHGKGGIIKFNVLKMGQNAADVILGTARDDENDVYKAGIVGVNAAPSQQARVPPASQAPITARQIQQNLPQPHYNPNYNPPNSKPAFEPRVETTDEDDMVRTHCDLVDSIYEQEDLIVRAHRRQVDSMMQLVKEEVALLHAIENDQVSIDDWLVKLSDILSRKEEAITTLKGNLSAFKQALQKEEELSHSIDLNKARKK |
Post-translational modification
Phosphorylated by PLK.
Keywords
- PTM
Interaction
Subunit
Interacts with PLK.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-240 | Kinesin motor | ||||
Sequence: GSGKSFTMMHKDNGIYVLACFDILEYLRVYNGSQGNNSKFLVPVVSFFEIYGGKLFDLLNNRQRLQALEDGKGNVQITGLTEKQISSVDAMLNLIDSGLTLRAVGATGANADSSRSHAILQIALKYTKSGKEYSRISFIDLAGSERASDVQNSDRQTRMEGAEINKSLLALKECIRAMDKSNDSKSGAHIPFRGSKLTMVLRDSFIGNSQTVMIANISPNDKSCDNTLNTLRYADRVKEL |
Sequence similarities
Family and domain databases
Sequence
- Sequence statusFragment
- Length439
- Mass (Da)48,642
- Last updated2001-12-01 v1
- Checksum404C43ABDE74B393
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: G |