Q960M4 · Q960M4_DROME
- ProteinPeroxiredoxin-5
- GenePrx5
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids190 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events.
Catalytic activity
- [thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O
RHEA-COMP:10698 CHEBI:29950 Position: nCHEBI:29950 Position: n+3+ CHEBI:35924 = RHEA-COMP:10700 CHEBI:50058 Position: n/n+3+ CHEBI:30879 + CHEBI:15377
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 79 | Cysteine sulfenic acid (-SOH) intermediate | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Cellular Component | peroxisomal matrix | |
Cellular Component | peroxisome | |
Molecular Function | thioredoxin peroxidase activity | |
Molecular Function | thioredoxin-dependent peroxiredoxin activity | |
Biological Process | cell redox homeostasis | |
Biological Process | cellular response to oxidative stress | |
Biological Process | determination of adult lifespan | |
Biological Process | hydrogen peroxide catabolic process | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | negative regulation of innate immune response | |
Biological Process | response to oxidative stress |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePeroxiredoxin-5
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ960M4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-190 | Thioredoxin | ||||
Sequence: VKVGDSLPSVDLFEDSPANKINTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLGGVRSKRYSLVVENGKVTELNVEPDGTGLSCSLANNIGKK |
Sequence similarities
Belongs to the peroxiredoxin family. Prx5 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length190
- Mass (Da)19,896
- Last updated2001-12-01 v1
- ChecksumF80D732AD511D25D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014297 EMBL· GenBank· DDBJ | AAF55497.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY051983 EMBL· GenBank· DDBJ | AAK93407.1 EMBL· GenBank· DDBJ | mRNA | ||
BT003526 EMBL· GenBank· DDBJ | AAO39530.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAO41575.1 EMBL· GenBank· DDBJ | Genomic DNA |