Q95WY7 · SP14_IXOSC
- ProteinAnticoagulant salivary protein 14
- GeneSalp14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids125 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Salivary anticoagulant protein that facilitates blood feeding of adult ticks on vertebrate species (PubMed:12421422, PubMed:14745044, PubMed:34118237).
Inhibits host coagulation factor Xa (F10) (PubMed:12421422).
Blocks the assembly and/or early activity of the prothrombinase complex (Xa-Va/F10-F5) (PubMed:34118237).
Inhibits the lectin pathway of complement system activation in the host (PubMed:34118237).
Inhibits host coagulation factor Xa (F10) (PubMed:12421422).
Blocks the assembly and/or early activity of the prothrombinase complex (Xa-Va/F10-F5) (PubMed:34118237).
Inhibits the lectin pathway of complement system activation in the host (PubMed:34118237).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameAnticoagulant salivary protein 14
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Acari > Parasitiformes > Ixodida > Ixodoidea > Ixodidae > Ixodinae > Ixodes
Accessions
- Primary accessionQ95WY7
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in impaired feeding of adult ticks, observed as decline in the engorgement weights (PubMed:14745044).
Decreased ability of salivary gland extracts from adult ticks to inhibit host clotting in vitro; when silenced together with Salp9Pac (PubMed:14745044).
No significant effects on the ability of nymphs to feed (PubMed:17038693).
Decreased ability of salivary gland extracts from adult ticks to inhibit host clotting in vitro; when silenced together with Salp9Pac (PubMed:14745044).
No significant effects on the ability of nymphs to feed (PubMed:17038693).
(Microbial infection) RNAi-mediated knockdown has no significant effects on acquisition of Borrelia burgdorferi by nymphs 72 hours after feeding.
(Microbial infection) RNAi-mediated knockdown has no significant effects on acquisition of Anaplasma phagocytophilum by nymphs 72 hours after feeding.
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MGLTGTMLVLVSLAFFGSAAA | ||||||
Chain | PRO_5004322241 | 22-125 | Anticoagulant salivary protein 14 | |||
Sequence: HNCQNGTRPASEQDREGCDYYCWNAETKSWDQFFFGNGEKCFYNSGDHGTCQNGECHLTNNSGGPNETDDYTPAPTEKPKQKKKKTKKTKKPKRKSKKDQEKNL | ||||||
Glycosylation | 26 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 81 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 87 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 75-90 | Polar residues | ||||
Sequence: GECHLTNNSGGPNETD | ||||||
Region | 75-125 | Disordered | ||||
Sequence: GECHLTNNSGGPNETDDYTPAPTEKPKQKKKKTKKTKKPKRKSKKDQEKNL | ||||||
Region | 91-125 | Responsible for anticoagulant activity | ||||
Sequence: DYTPAPTEKPKQKKKKTKKTKKPKRKSKKDQEKNL | ||||||
Compositional bias | 101-118 | Basic residues | ||||
Sequence: KQKKKKTKKTKKPKRKSK |
Sequence similarities
Belongs to the salp14 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length125
- Mass (Da)13,979
- Last updated2001-12-01 v1
- ChecksumC3D02F586E2AE07B
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 75-90 | Polar residues | ||||
Sequence: GECHLTNNSGGPNETD | ||||||
Compositional bias | 101-118 | Basic residues | ||||
Sequence: KQKKKKTKKTKKPKRKSK |
Keywords
- Technical term