Q95U54 · MMS19_DROME
- ProteinMMS19 nucleotide excision repair protein
- GeneMms19
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids959 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into apoproteins specifically involved in DNA metabolism and genomic integrity (By similarity).
In the CIA complex, MMS19 acts as an adapter between early-acting CIA components and a subset of cellular target iron-sulfur proteins (By similarity).
Essential for diploid cell cycles, organ growth and development (PubMed:29361561).
Regulates mitosis by binding to Xpd and thereby competing with the Xpd-mediated repression on the Cdk-activating kinase (CAK) complex (PubMed:29361561).
Regulates the centrosomal localization of the MT regulator tacc, a downstream target of aurA kinase (PubMed:33211700).
Binds to microtubules (MT) (PubMed:33211700).
Regulates spindle and astral MT growth, MT stability and bundling (PubMed:33211700).
In neuroblasts, necessary for timely and coordinated spindle assembly and orientation which is necessary for mitotic progression (PubMed:33211700).
In young embryos, the maternal protein is important for progression through mitosis (PubMed:29361561).
In the CIA complex, MMS19 acts as an adapter between early-acting CIA components and a subset of cellular target iron-sulfur proteins (By similarity).
Essential for diploid cell cycles, organ growth and development (PubMed:29361561).
Regulates mitosis by binding to Xpd and thereby competing with the Xpd-mediated repression on the Cdk-activating kinase (CAK) complex (PubMed:29361561).
Regulates the centrosomal localization of the MT regulator tacc, a downstream target of aurA kinase (PubMed:33211700).
Binds to microtubules (MT) (PubMed:33211700).
Regulates spindle and astral MT growth, MT stability and bundling (PubMed:33211700).
In neuroblasts, necessary for timely and coordinated spindle assembly and orientation which is necessary for mitotic progression (PubMed:33211700).
In young embryos, the maternal protein is important for progression through mitosis (PubMed:29361561).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosolic [4Fe-4S] assembly targeting complex | |
Cellular Component | midbody | |
Cellular Component | nucleus | |
Cellular Component | spindle | |
Cellular Component | spindle microtubule | |
Biological Process | astral microtubule organization | |
Biological Process | cell division | |
Biological Process | chromosome segregation | |
Biological Process | DNA repair | |
Biological Process | mitotic nuclear division | |
Biological Process | positive regulation of microtubule polymerization | |
Biological Process | positive regulation of mitotic nuclear division | |
Biological Process | protein maturation by iron-sulfur cluster transfer |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMMS19 nucleotide excision repair protein
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ95U54
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to the nucleus at the beginning of metaphase.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Shows slowed larval development with lack of imaginal disks and microcephaly with deformed and underdeveloped optical lobes (PubMed:29361561, PubMed:33211700).
Death occurs at the third larval instar stage (PubMed:29361561, PubMed:33211700).
Reduced levels of Xpd in embryos (PubMed:29361561).
Results in higher proportion of neuroblasts in mitosis with shorter spindle and less dense astral microtubules with defective assembly and orientation (PubMed:33211700).
Loss of maternal Mms19 causes cell cycle defects in young embryos (PubMed:29361561).
Death occurs at the third larval instar stage (PubMed:29361561, PubMed:33211700).
Reduced levels of Xpd in embryos (PubMed:29361561).
Results in higher proportion of neuroblasts in mitosis with shorter spindle and less dense astral microtubules with defective assembly and orientation (PubMed:33211700).
Loss of maternal Mms19 causes cell cycle defects in young embryos (PubMed:29361561).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000452275 | 1-959 | MMS19 nucleotide excision repair protein | |||
Sequence: MTTPTRATLEKALKSDQKLVNSATQIAKDLTAKAYDISALAEALGFALSSPDMEERVAGTNLLSAVLIALPQDLLQERQLEFLSTFYMDRLRDHHNVMPAIIDGIDALVHMKALPRAQIPQILQSFFEHTTCQSQTRSDRTKLFHIFQYLTENFQDELQAMAGDFVYGLINSIDGERDPRNLDIIFSFMPEFLSTYPLLHLAEEMFEIFACYFPIDFNPSKQDPAAITRDELSKKLTNCLVANNEFAEGTVVLAIEKLESELLVAKLDSIELLHQAAVKFPPSVLEPHFDQIWQALKTETFPGNDNEEILKASLKALSALLERAAHIPDISHSYQSSILGVILPHLSDVNQRLFHPATGIALVCVSGDAPYAADKILNSFLLKLQAADASSEQRIKIYYIVSQVYKLSALRGSLQKLDTTIRESVQDDVIASLRLIEQEEFDAKKEDLELQKAALSVLNESAPLLNEKQRALIYKALVQLVSHPSIDIDFTTLTVSLGALQPVEVQSNFIDVCVRNFEIFSTFVKRKIYTNLLPLMPQIAFTQRILDLVMTQTFNDTTAEPVRLLALEALNKLLLLADQRFIVDVQQESNLLHKLIELGQKTEGLSMQSLEQIAGALSRITQQLPLSEQSAIVSEYLPGLNLSQSADLYITKGLLGYLHKDITLDDHFERLLTDLTQLSLNSDNEQLRVIAHHLLCSMVNKMESNPANLRKVKKITEQLKVAIKKGDVRAVEILAWVGKGLVVAGFDEAADVVGDLSDLLKHPSLSTAAALGFDIIAAEYPELDLPVVKFLYKQKLFHTIMGKMGSKLANYCVHHLKAFVYVLKATPQAVIKLNIEQLGPLLFKSLEEHNEAQSLCIALGICEKFVAQQDTYFQGHLAHLIPSCLELSKYKAQHTMQVRIAALQLLYDVTKYPTFVLLPHKVDVTLALAAALDDPKRLVRNTAVKARNAWYLVGAPSPN |
Proteomic databases
Expression
Tissue specificity
Expressed in embryos (at protein level).
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 794-828 | HEAT 1 | ||||
Sequence: QKLFHTIMGKMGSKLANYCVHHLKAFVYVLKATPQ | ||||||
Repeat | 832-871 | HEAT 2 | ||||
Sequence: KLNIEQLGPLLFKSLEEHNEAQSLCIALGICEKFVAQQDT | ||||||
Repeat | 874-915 | HEAT 3 | ||||
Sequence: QGHLAHLIPSCLELSKYKAQHTMQVRIAALQLLYDVTKYPTF | ||||||
Repeat | 918-956 | HEAT 4 | ||||
Sequence: LPHKVDVTLALAAALDDPKRLVRNTAVKARNAWYLVGAP |
Sequence similarities
Belongs to the MET18/MMS19 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length959
- Mass (Da)107,048
- Last updated2001-12-01 v1
- Checksum363EAF00E63F3B2C
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 551 | in Ref. 1; AAK52669 | ||||
Sequence: T → A | ||||||
Sequence conflict | 710 | in Ref. 1; AAK52669 | ||||
Sequence: R → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF319948 EMBL· GenBank· DDBJ | AAK52669.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAN13264.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY058300 EMBL· GenBank· DDBJ | AAL13529.1 EMBL· GenBank· DDBJ | mRNA |