Q95NH6 · ATTC_DROME
- ProteinAttacin-C
- GeneAttC
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids241 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has antimicrobial activity in synergy with other peptides. Strongest activity observed against E.cloacae.
Miscellaneous
Not induced by bacterial challenge in imd mutant flies. Level of induction reduced by over 90% in 18w mutant flies. Toll loss-of-function mutation has no effect on induction by a mixture of E.coli and M.luteus; but strongly reduces induction by E.cloacae.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Biological Process | antibacterial humoral response | |
Biological Process | defense response | |
Biological Process | defense response to Gram-positive bacterium | |
Biological Process | humoral immune response | |
Biological Process | innate immune response | |
Biological Process | response to bacterium |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAttacin-C
- Cleaved into 1 chains
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ95NH6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 27-45 | in strain: Berkeley | ||||
Sequence: Missing | ||||||
Natural variant | 165 | in strain: Berkeley | ||||
Sequence: G → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, propeptide, modified residue, peptide, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MSKIVLLIVVIVGVLGSLAVA | ||||||
Propeptide | PRO_0000004897 | 22-23 | ||||
Sequence: LP | ||||||
Modified residue | 24 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Peptide | PRO_0000004899 | 24-46 | Immune-induced peptide 16 | |||
Sequence: QRPYTQPLIYYPPPPTPPRIYRA | ||||||
Chain | PRO_0000004898 | 24-241 | Attacin-C | |||
Sequence: QRPYTQPLIYYPPPPTPPRIYRARRQVLGGSLTSNPSGGADARLDLSKAVGTPDHHVIGQVFAAGNTQTKPVSTPVTSGATLGYNNHGHGLELTKTHTPGVRDSFQQTATANLFNNGVHNLDAKAFASQNQLANGFKFDRNGAALDYSHIKGHGATLTHANIPGLGKQLELGGRANLWQSQDRNTRLDLGSTASKWTSGPFKGQTDLGANLGLSHYFG | ||||||
Glycosylation | 39 | O-linked (GalNAc...) threonine | ||||
Sequence: T | ||||||
Modified residue | 127 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Sequence similarities
Belongs to the attacin/sarcotoxin-2 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length241
- Mass (Da)25,535
- Last updated2001-12-01 v1
- ChecksumDA3DF6310219B1C1
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 4 | in Ref. 2; AAL23633/AAL23634 | ||||
Sequence: I → T | ||||||
Sequence conflict | 8 | in Ref. 2; AAL23640 | ||||
Sequence: I → F | ||||||
Sequence conflict | 84 | in Ref. 2; AAL23635/AAL23638/AAL23639 | ||||
Sequence: V → L | ||||||
Sequence conflict | 173 | in Ref. 1; AAG42833 | ||||
Sequence: I → V | ||||||
Sequence conflict | 239 | in Ref. 2; AAL23634/AAL23639 | ||||
Sequence: Y → S |
Mass Spectrometry
Immune-induced peptide 16
Molecular mass is 2,972.38 Da. Determined by MALDI.Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF322248 EMBL· GenBank· DDBJ | AAG42832.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF322249 EMBL· GenBank· DDBJ | AAG42833.2 EMBL· GenBank· DDBJ | mRNA | ||
AY056843 EMBL· GenBank· DDBJ | AAL23629.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056844 EMBL· GenBank· DDBJ | AAL23630.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056845 EMBL· GenBank· DDBJ | AAL23631.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056846 EMBL· GenBank· DDBJ | AAL23632.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056847 EMBL· GenBank· DDBJ | AAL23633.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056848 EMBL· GenBank· DDBJ | AAL23634.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056849 EMBL· GenBank· DDBJ | AAL23635.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056850 EMBL· GenBank· DDBJ | AAL23636.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056851 EMBL· GenBank· DDBJ | AAL23637.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056852 EMBL· GenBank· DDBJ | AAL23638.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056853 EMBL· GenBank· DDBJ | AAL23639.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY056854 EMBL· GenBank· DDBJ | AAL23640.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE013599 EMBL· GenBank· DDBJ | AAM68570.2 EMBL· GenBank· DDBJ | Genomic DNA |