Q95L88 · SFTPA_HORSE
- ProteinPulmonary surfactant-associated protein A
- GeneSFTPA1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids248 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | collagen trimer | |
Cellular Component | extracellular space | |
Cellular Component | multivesicular body | |
Molecular Function | carbohydrate binding | |
Molecular Function | metal ion binding | |
Biological Process | respiratory gaseous exchange by respiratory system |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended namePulmonary surfactant-associated protein A
- Short namesPSAP; PSP-A; SP-A
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Perissodactyla > Equidae > Equus
Accessions
- Primary accessionQ95L88
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MLLCSLTLTLILLAVSGTKC | ||||||
Chain | PRO_0000017456 | 21-248 | Pulmonary surfactant-associated protein A | |||
Sequence: DVKEFCAACSGVPGIPGSPGLPGRDGRDGVKGDPGPPGPIGPPGGMPGSPGHDGLIGPPGPPGERGDKGEPGERGPPGPPAYPDEELQTTLHDIRHQILQLMGALSLQGSMLAVGEKVFSTNGQVVDFDAIRESCARAGGRIAVPKSLEENAAIASLVTKHNTYAYLGLEEGPTAGDFYYLDGAPVNYTNWYPGEPRGRGKEKCVEMYTDGQWNDRSCLQYRLAICEF | ||||||
Disulfide bond | 26 | Interchain | ||||
Sequence: C | ||||||
Disulfide bond | 155↔246 | |||||
Sequence: CARAGGRIAVPKSLEENAAIASLVTKHNTYAYLGLEEGPTAGDFYYLDGAPVNYTNWYPGEPRGRGKEKCVEMYTDGQWNDRSCLQYRLAIC | ||||||
Glycosylation | 207 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 224↔238 | |||||
Sequence: CVEMYTDGQWNDRSC |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 31-100 | Collagen-like | ||||
Sequence: GVPGIPGSPGLPGRDGRDGVKGDPGPPGPIGPPGGMPGSPGHDGLIGPPGPPGERGDKGEPGERGPPGPP | ||||||
Region | 34-105 | Disordered | ||||
Sequence: GIPGSPGLPGRDGRDGVKGDPGPPGPIGPPGGMPGSPGHDGLIGPPGPPGERGDKGEPGERGPPGPPAYPDE | ||||||
Domain | 134-247 | C-type lectin | ||||
Sequence: VGEKVFSTNGQVVDFDAIRESCARAGGRIAVPKSLEENAAIASLVTKHNTYAYLGLEEGPTAGDFYYLDGAPVNYTNWYPGEPRGRGKEKCVEMYTDGQWNDRSCLQYRLAICE |
Sequence similarities
Belongs to the SFTPA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length248
- Mass (Da)26,047
- Last updated2001-12-01 v1
- ChecksumB71133E005C9A5C1
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 128 | in Ref. 1; BAA97976 | ||||
Sequence: Q → L | ||||||
Sequence conflict | 131 | in Ref. 1; BAA97976 | ||||
Sequence: M → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB015963 EMBL· GenBank· DDBJ | BAA97976.1 EMBL· GenBank· DDBJ | mRNA | ||
AF400580 EMBL· GenBank· DDBJ | AAL07690.1 EMBL· GenBank· DDBJ | Genomic DNA |