Q95L74 · CY24B_BISBI
- ProteinCytochrome b-245 heavy chain
- GeneCYBB
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids570 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H+ currents of resting phagocytes.
Cofactor
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 101 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 115 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 209 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 222 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 338-344 | FAD (UniProtKB | ChEBI) | ||||
Sequence: HPFTLTS |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | monoatomic ion channel complex | |
Cellular Component | NADPH oxidase complex | |
Molecular Function | metal ion binding | |
Molecular Function | superoxide-generating NAD(P)H oxidase activity | |
Biological Process | inflammatory response | |
Biological Process | innate immune response | |
Biological Process | monoatomic ion transmembrane transport | |
Biological Process | superoxide anion generation | |
Biological Process | superoxide metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome b-245 heavy chain
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bison
Accessions
- Primary accessionQ95L74
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Note: As unassembled monomer may localize to the endoplasmic reticulum.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-8 | Cytoplasmic | ||||
Sequence: MGNWVVNE | ||||||
Transmembrane | 9-29 | Helical | ||||
Sequence: GISIFVILVWLGMNVFLFVWY | ||||||
Topological domain | 30-48 | Extracellular | ||||
Sequence: YRVYDIPDKFFYTRKLLGS | ||||||
Transmembrane | 49-69 | Helical | ||||
Sequence: ALALARAPAACLNFNCMLILL | ||||||
Topological domain | 70-102 | Cytoplasmic | ||||
Sequence: PVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHK | ||||||
Transmembrane | 103-123 | Helical | ||||
Sequence: MVAWMIALHTAIHTIAHLFNV | ||||||
Topological domain | 124-169 | Extracellular | ||||
Sequence: EWCVNARVNNSDPYSIALSDIGDKPNETYLNFVRQRIKNPEGGLYV | ||||||
Transmembrane | 170-190 | Helical | ||||
Sequence: AVTLLAGITGVVITLCLILII | ||||||
Topological domain | 191-200 | Cytoplasmic | ||||
Sequence: TSSTKTIRRS | ||||||
Transmembrane | 201-221 | Helical | ||||
Sequence: YFEVFWYTHHLFVIFFIGLAI | ||||||
Topological domain | 222-261 | Extracellular | ||||
Sequence: HGAQRIVRGQTAESLLKHQPRNCYQNISQWGKIKDCPIPE | ||||||
Transmembrane | 262-282 | Helical | ||||
Sequence: FSGNPPMTWKWIVGPMFLYLC | ||||||
Topological domain | 283-570 | Cytoplasmic | ||||
Sequence: ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPVVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNKAPNLRLKKIYFYWLCRDTHAFEWFADLLQLLETQMQEKNNTDFLSYNICLTGWDESQASHFAMHHDEEKDVITGLKQKTLYGRPNWDNEFKTIGSQHPNTRIGVFLCGPEALADTLNKQCISNSDSGPRGVHFIFNKENF |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, glycosylation, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000210143 | 1-570 | Cytochrome b-245 heavy chain | |||
Sequence: MGNWVVNEGISIFVILVWLGMNVFLFVWYYRVYDIPDKFFYTRKLLGSALALARAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGDKPNETYLNFVRQRIKNPEGGLYVAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAQRIVRGQTAESLLKHQPRNCYQNISQWGKIKDCPIPEFSGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPVVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNKAPNLRLKKIYFYWLCRDTHAFEWFADLLQLLETQMQEKNNTDFLSYNICLTGWDESQASHFAMHHDEEKDVITGLKQKTLYGRPNWDNEFKTIGSQHPNTRIGVFLCGPEALADTLNKQCISNSDSGPRGVHFIFNKENF | ||||||
Glycosylation | 132 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 149 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Cross-link | 161 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Glycosylation | 247 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Cross-link | 255 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 294 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 299 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 306 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 328 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 334 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 381 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 506 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 567 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K |
Post-translational modification
Phosphorylated on Ser and Thr residues.
Undergoes 'Lys-48'-linked polyubiquitination, likely by RNF145, triggering endoplasmic reticulum-associated degradation.
Keywords
- PTM
PTM databases
Interaction
Subunit
Composed of a heavy chain (beta) and a light chain (alpha). Component of an NADPH oxidase complex composed of a heterodimer formed by the membrane proteins CYBA and CYBB and the cytosolic subunits NCF1, NCF2 and NCF4. Interacts with NCF1. Interacts with calprotectin (S100A8/9). Interacts with NRROS; the interaction is direct and impairs formation of a stable NADPH oxidase complex. Interacts with CYBC1; CYBC1 may act as a chaperone stabilizing Cytochrome b-245 heterodimer (By similarity).
Interacts with NCF2; the interaction is enhanced in the presence of GBP7 (By similarity).
The CYBA-CYBB complex interacts with GBP7 (By similarity).
Interacts with NCF2; the interaction is enhanced in the presence of GBP7 (By similarity).
The CYBA-CYBB complex interacts with GBP7 (By similarity).
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 54-286 | Ferric oxidoreductase | ||||
Sequence: RAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGDKPNETYLNFVRQRIKNPEGGLYVAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAQRIVRGQTAESLLKHQPRNCYQNISQWGKIKDCPIPEFSGNPPMTWKWIVGPMFLYLCERLV | ||||||
Domain | 287-397 | FAD-binding FR-type | ||||
Sequence: RFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPVVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIAVDGPFGTASED |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length570
- Mass (Da)65,600
- Last updated2001-12-01 v1
- Checksum94F9D1E833E19848