Q95747 · RM16_ARATH
- ProteinLarge ribosomal subunit protein uL16m
- GeneRPL16
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids179 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial large ribosomal subunit | |
Molecular Function | rRNA binding | |
Molecular Function | structural constituent of ribosome | |
Biological Process | mitochondrial translation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameLarge ribosomal subunit protein uL16m
- Alternative names
Gene names
Encoded on
- Mitochondrion
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ95747
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000062321 | 1-179 | Large ribosomal subunit protein uL16m | |||
Sequence: MYLTIKSIMLLWKYLLVTESQVSKCGFHIVKKKGDVLYPKRTKYSKYRKGRCSRGCKPDGTKLGFGRYGIKSCKAGRLSYRAIEAARRAIIGHFHRAMSGQFRRNGKIWVRVFADLPITGKPTEVRMGRGKGNPTGWIARVSTGQILFEMDGVSLANARQAATLAAHKLCLSTKFVQWS |
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length179
- Mass (Da)20,147
- Last updated2023-09-13 v4
- Checksum484BE2EFD029F363
RNA Editing
Edited at positions 12 70 77 147 169 171
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y08501 EMBL· GenBank· DDBJ | CAA69754.3 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
BK010421 EMBL· GenBank· DDBJ | DAB41498.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
D82062 EMBL· GenBank· DDBJ | BAA11531.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
EF488940 EMBL· GenBank· DDBJ | ABS50652.1 EMBL· GenBank· DDBJ | mRNA | ||
EF488941 EMBL· GenBank· DDBJ | ABS50653.1 EMBL· GenBank· DDBJ | mRNA |