Q94FY2 · FRI_MALBX
- ProteinFerritin, chloroplastic
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids250 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation (By similarity).
Catalytic activity
- 4 Fe2+ + 4 H+ + O2 = 4 Fe3+ + 2 H2O
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 100 | Fe cation 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 135 | Fe cation 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 135 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 138 | Fe cation 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 184 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 218 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | ferric iron binding | |
Molecular Function | ferrous iron binding | |
Molecular Function | ferroxidase activity | |
Biological Process | intracellular sequestering of iron ion | |
Biological Process | iron ion transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFerritin, chloroplastic
- EC number
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Rosales > Rosaceae > Amygdaloideae > Maleae > Malus
Accessions
- Primary accessionQ94FY2
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-49 | Chloroplast | ||||
Sequence: MALAPSKVSTFSGFSPKPSVGGAQKNPTCSVSLSFLNEKLGSRNLRVCA | ||||||
Chain | PRO_0000008861 | 50-250 | Ferritin, chloroplastic | |||
Sequence: STVPLTGVIFEPFEEVKKSELAVPTAPQVSLARQNYADECESAINEQINVEYNASYVYHSLFAYFDRDNVALKGFAKFFKESSEEEREHAEKLMKYQNTRGGRVVLHAIKNVPSEFEHVEKGDALYAMELALSLEKLVNEKLLNVHSVADRNNDPQMADFIESEFLSEQVESIKKISEYVAQLRRVGKGHGVWHFDQRLLD |
Interaction
Subunit
Oligomer of 24 subunits. There are two types of subunits: L (light) chain and H (heavy) chain. The major chain can be light or heavy, depending on the species and tissue type. The functional molecule forms a roughly spherical shell with a diameter of 12 nm and contains a central cavity into which the insoluble mineral iron core is deposited (By similarity).
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 50-82 | Extension peptide (EP) | ||||
Sequence: STVPLTGVIFEPFEEVKKSELAVPTAPQVSLAR | ||||||
Domain | 83-236 | Ferritin-like diiron | ||||
Sequence: QNYADECESAINEQINVEYNASYVYHSLFAYFDRDNVALKGFAKFFKESSEEEREHAEKLMKYQNTRGGRVVLHAIKNVPSEFEHVEKGDALYAMELALSLEKLVNEKLLNVHSVADRNNDPQMADFIESEFLSEQVESIKKISEYVAQLRRVG |
Sequence similarities
Belongs to the ferritin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length250
- Mass (Da)28,053
- Last updated2001-12-01 v1
- Checksum20EF3C1CF2A0DCDE