Q94F58 · NAC89_ARATH
- ProteinNAC domain-containing protein 89
- GeneNAC089
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids340 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor involved in plant cell division.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 119-170 | |||||
Sequence: IGTKRTLVFHIGRAPKGERTDWIMHEYCVKGVSLDDAMVVCRVRRNKEYNSG |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | negative regulation of flower development | |
Biological Process | plant-type hypersensitive response | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | response to endoplasmic reticulum stress |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNAC domain-containing protein 89
- Short namesANAC089
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ94F58
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000416138 | 1-340 | NAC domain-containing protein 89 | |||
Sequence: MDTKAVGVSKDTAASMEASTVFPGFKFSPTDVELISYYLKRKMDGLERSVEVIPDLEIYNFEPWDLPDKSIVKSDSEWFFFCARGKKYPHGSQNRRATKMGYWKATGKERDVKSGSEVIGTKRTLVFHIGRAPKGERTDWIMHEYCVKGVSLDDAMVVCRVRRNKEYNSGTSQKAPKPNSSAEKHAKVQNGATSSGSPSDWDNLVDFYLAGESGEKLLAEMAESSENLQVDNDEDFFADILRDEIINLDEAVMTGNTPNEVPTLESASMEIRVLPLPNMIDKQMSSLLEERPSQKKKGKDATESLSSCFVGLYSIKSVNKARWDVIIGVVALIAMLFYLE |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with PAS1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q94F58 | AGP14 Q9LVC0 | 2 | EBI-2319707, EBI-4429269 | |
BINARY | Q94F58 | At5g44550 Q9FI10 | 2 | EBI-2319707, EBI-4440466 | |
BINARY | Q94F58 | PAS1 Q7DMA9 | 6 | EBI-2319707, EBI-637668 | |
BINARY | Q94F58 | PDF1.3 O80995 | 3 | EBI-2319707, EBI-25522494 | |
BINARY | Q94F58 | PYL4 O80920 | 3 | EBI-2319707, EBI-2349683 | |
BINARY | Q94F58 | PYL7 Q1ECF1 | 3 | EBI-2319707, EBI-2363203 | |
BINARY | Q94F58 | PYL9 Q84MC7 | 3 | EBI-2319707, EBI-2349513 | |
BINARY | Q94F58 | TOM20-3 P82874 | 2 | EBI-2319707, EBI-2352074 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 21-164 | NAC | ||||
Sequence: VFPGFKFSPTDVELISYYLKRKMDGLERSVEVIPDLEIYNFEPWDLPDKSIVKSDSEWFFFCARGKKYPHGSQNRRATKMGYWKATGKERDVKSGSEVIGTKRTLVFHIGRAPKGERTDWIMHEYCVKGVSLDDAMVVCRVRRN | ||||||
Region | 167-198 | Disordered | ||||
Sequence: YNSGTSQKAPKPNSSAEKHAKVQNGATSSGSP |
Domain
The NAC domain includes a DNA-binding domain and a dimerization domain.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length340
- Mass (Da)38,046
- Last updated2001-12-01 v1
- Checksum14DB0290E32E15C1
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8BAF4 | A0A1P8BAF4_ARATH | NAC089 | 241 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB007651 EMBL· GenBank· DDBJ | BAB08327.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AL589883 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002688 EMBL· GenBank· DDBJ | AED93007.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF385685 EMBL· GenBank· DDBJ | AAK60278.1 EMBL· GenBank· DDBJ | mRNA | ||
AY078006 EMBL· GenBank· DDBJ | AAL77707.1 EMBL· GenBank· DDBJ | mRNA |