Q94C95 · ATG1A_ARATH
- ProteinSerine/threonine-protein kinase ATG1a
- GeneATG1A
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids626 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Serine/threonine protein kinase involved in autophagy in a nutritional condition-dependent manner. The ATG1-ATG13 protein kinase complex regulates downstream events required for autophagosome enclosure and/or vacuolar delivery. Becomes a target of autophagy under nutrient starvation. Connects autophagy to plant nutritional status.
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | autophagosome | |
Cellular Component | cytoplasmic vesicle | |
Molecular Function | ATP binding | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | autophagy | |
Biological Process | protein transport | |
Biological Process | regulation of autophagy |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein kinase ATG1a
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ94C95
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype under normal growth conditions.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 360 | Loss of binding to ATG8E; when associated with A-363. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 363 | Loss of binding to ATG8E; when associated with A-360. | ||||
Sequence: V → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 33 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000434619 | 1-626 | Serine/threonine-protein kinase ATG1a | |||
Sequence: MESARLVGDYALGPRIGSGSFAVVWLAKHRSSGLEVAVKEIDKKLLSPKVRDNLLKEISILSTIDHPNIIRFYEAIETGDRIFLVLEYCSGGDLAGYINRHGKVPEAVAKHFMRQLALGLQVLQEKHFIHRDLKPQNLLLSSKEVTPLLKIGDFGFARSLTPESMAETFCGSPLYMAPEIIRNQKYDAKADLWSAGAILFQLVTGKPPFDGNNHIQLFHNIVRDTELKFPEDTRNEIHPDCVDLCRSLLRRNPIERLTFREFFNHMFLREPRQIPDVEHSGFSTCTGKSLLPSAQPSTSTNRFKSSAENVHKHGSSSSASNSQISMPHTSFEKTRKDTEGQCSSNQSGVVDSLELIEREYVLVNRPSASLEGSSDCFDTSLQDSGFPNILPRNEKVSSSSLEAQKPLSDVSGPRPASVSYLLTEVQRLTIVHPPTKLQLLHQYAQALTELASEMGNTGQVKESFAVTLVVLAVWRKALEICDSWMMSVGENEVNPDPTTAPETSIPDLNSPAPAKTWVTQEFVTALNQAENLSTQLNETSAATHMPDAMETIYERALAYGKSGGAEEYLSNKESAATLYKKAILLLSFIIEEAVTLSLNPSFSLTPDDKKRILYYISNLQHRRSHL |
Post-translational modification
Phosphorylated during nutrient starvation. Dephosphorylated in nutrient-rich conditions.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 10-268 | Protein kinase | ||||
Sequence: YALGPRIGSGSFAVVWLAKHRSSGLEVAVKEIDKKLLSPKVRDNLLKEISILSTIDHPNIIRFYEAIETGDRIFLVLEYCSGGDLAGYINRHGKVPEAVAKHFMRQLALGLQVLQEKHFIHRDLKPQNLLLSSKEVTPLLKIGDFGFARSLTPESMAETFCGSPLYMAPEIIRNQKYDAKADLWSAGAILFQLVTGKPPFDGNNHIQLFHNIVRDTELKFPEDTRNEIHPDCVDLCRSLLRRNPIERLTFREFFNHMFL | ||||||
Compositional bias | 288-329 | Polar residues | ||||
Sequence: KSLLPSAQPSTSTNRFKSSAENVHKHGSSSSASNSQISMPHT | ||||||
Region | 288-347 | Disordered | ||||
Sequence: KSLLPSAQPSTSTNRFKSSAENVHKHGSSSSASNSQISMPHTSFEKTRKDTEGQCSSNQS | ||||||
Motif | 360-363 | AIM (Atg8-family-interacting motif) | ||||
Sequence: YVLV |
Sequence similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
This entry describes 1 isoforms produced by Alternative splicing. A number of isoforms are produced. According to EST sequences.
Q94C95-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length626
- Mass (Da)69,602
- Last updated2001-12-01 v1
- Checksum1C1DDE548EB5E0B0
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F4IX14 | F4IX14_ARATH | ATG1A | 584 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 288-329 | Polar residues | ||||
Sequence: KSLLPSAQPSTSTNRFKSSAENVHKHGSSSSASNSQISMPHT |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL138642 EMBL· GenBank· DDBJ | CAB71903.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE80285.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY035049 EMBL· GenBank· DDBJ | AAK59554.1 EMBL· GenBank· DDBJ | mRNA |