Q94BT9 · ATOX1_ARATH
- ProteinCopper transport protein ATX1
- GeneATX1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Plays an important role in copper homeostasis by conferring tolerance to excess of copper and subclinical copper deficiency during vegetative stage. Can complement the yeast mutants atx1 and sod1.
Miscellaneous
Over-expression of ATX1 confers increased tolerance to copper excess as well as subclinical copper deficiency (PubMed:22555879), but over-expressing plants are hypersensitive to severe copper deficiency (PubMed:22899077).
Cofactor
Note: Binds 1 copper ion per subunit.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Cellular Component | secretory vesicle | |
Molecular Function | metal ion binding | |
Biological Process | copper ion transport |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCopper transport protein ATX1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ94BT9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype under normal growth conditions, but mutant plants have increased sensitivity to excess of copper.
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000422760 | 2-76 | Copper transport protein ATX1 | |||
Sequence: SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWEAEGETAKA |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-65 | HMA | ||||
Sequence: SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTA |
Sequence similarities
Belongs to the ATX1 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q94BT9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length76
- Mass (Da)8,158
- Last updated2015-10-14 v2
- Checksum30874B7A605AB8F0
Q94BT9-2
- Name2
- Differences from canonical
- 1-10: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F4ID99 | F4ID99_ARATH | ATX1 | 41 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_046614 | 1-10 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 69 | in Ref. 4; BAH57197 | ||||
Sequence: A → V |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC066691 EMBL· GenBank· DDBJ | AAG51766.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
CP002684 EMBL· GenBank· DDBJ | AEE34481.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
CP002684 EMBL· GenBank· DDBJ | AEE34482.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY039898 EMBL· GenBank· DDBJ | AAK64002.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AY077678 EMBL· GenBank· DDBJ | AAL76156.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK319082 EMBL· GenBank· DDBJ | BAH57197.1 EMBL· GenBank· DDBJ | mRNA |