Q94BS2 · MET1_ARATH
- ProteinProtein MET1, chloroplastic
- GeneMET1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids335 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in photosystem II supercomplex formation and repair, probably acting as a psbB/psbC chaperone on the stromal side of the membrane.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast envelope | |
Cellular Component | chloroplast membrane | |
Cellular Component | chloroplast stroma | |
Cellular Component | chloroplast thylakoid | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | chromoplast stroma | |
Cellular Component | nucleus | |
Cellular Component | photosystem II | |
Cellular Component | stromal side of plastid thylakoid membrane | |
Cellular Component | thylakoid | |
Biological Process | photosynthesis | |
Biological Process | photosystem II assembly | |
Biological Process | photosystem II repair | |
Biological Process | response to high light intensity | |
Biological Process | response to light stimulus | |
Biological Process | response to wounding |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein MET1, chloroplastic
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ94BS2
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Note: In thylakoids, enriched in stroma lamellae, and also present in grana.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Conditional reduced growth in fluctuating white light intensities conditions, with near complete blockage in photosystem II (PSII) supercomplex formation, and concomitant increase of unassembled psbC (CP43), thus leading to reduced PSII efficiency and biomass accumulation. Increased sensitivity to high light conditions, associated with the loss of PSII supercomplexes and accelerated D1 degradation.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 16 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-73 | Chloroplast | ||||
Sequence: MSLAPSSYPSLYSSPSLPRTQQTKQNPSLITQSSFISAKSLFLSSNSASLCNTHVAKRRNLALKASETESSAK | ||||||
Chain | PRO_0000440118 | 74-335 | Protein MET1, chloroplastic | |||
Sequence: AEAGGDGEEEEKYETYEIEVEQPYGLKFRKGRDGGTYIDAILPGGSADKTGKFTVGDRVIATSAVFGTEIWPAAEYGRTMYTIRQRIGPLLMQMEKRNGKAEDTGELTEKEIIRAERNAGYISSRLREIQMQNYLKKKEQKAQREKDLREGLQFSKNGKYEEALERFESVLGSKPTPEEASVASYNVACCYSKLNQVQAGLSALEEALKSGYEDFKRIRSDPDLETLRKSKDFDPLLKQFDESFINESAINAIKSLFGFNKK |
Post-translational modification
Phosphorylated rapidly (e.g. within 5 minutes) but transiently at threonine and serine residues after wounding.
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in leaves (at protein level) (PubMed:15914918).
Mostly expressed in leaves, stems and siliques, and, to a lower extent, in flowers and senescent leaves, but not present in roots (at protein level) (PubMed:25587003).
Mostly expressed in leaves, stems and siliques, and, to a lower extent, in flowers and senescent leaves, but not present in roots (at protein level) (PubMed:25587003).
Induction
Repressed by wounding at the transcript level, but not at the protein level (PubMed:15914918).
Strong level decrease during senescence. Low levels observed in etiolated leaves and accumulates rapidly during light-induced greening (PubMed:25587003).
Strong level decrease during senescence. Low levels observed in etiolated leaves and accumulates rapidly during light-induced greening (PubMed:25587003).
Gene expression databases
Interaction
Subunit
Interacts directly with stromal loops of photosystem II (PSII) core components psbB (CP47) and psbC (CP43). Associates with PSII subcomplexes formed during the PSII repair cycle (e.g. PSII dimers, PSII monomers, CP43-less PSII monomerand PSII reaction centers).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-29 | Disordered | ||||
Sequence: MSLAPSSYPSLYSSPSLPRTQQTKQNPSL | ||||||
Region | 66-88 | Disordered | ||||
Sequence: SETESSAKAEAGGDGEEEEKYET | ||||||
Domain | 97-136 | PDZ | ||||
Sequence: YGLKFRKGRDGGTYIDAILPGGSADKTGKFTVGDRVIATS | ||||||
Repeat | 217-250 | TPR 1 | ||||
Sequence: REKDLREGLQFSKNGKYEEALERFESVLGSKPTP | ||||||
Repeat | 254-287 | TPR 2 | ||||
Sequence: SVASYNVACCYSKLNQVQAGLSALEEALKSGYED | ||||||
Repeat | 289-323 | TPR 3 | ||||
Sequence: KRIRSDPDLETLRKSKDFDPLLKQFDESFINESAI |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length335
- Mass (Da)37,410
- Last updated2001-12-01 v1
- ChecksumE83B3BF8EEB39E51
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 161 | in Ref. 6; AAM66135 | ||||
Sequence: G → C |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB190499 EMBL· GenBank· DDBJ | BAD99102.1 EMBL· GenBank· DDBJ | mRNA | ||
AY986818 EMBL· GenBank· DDBJ | AAY42135.1 EMBL· GenBank· DDBJ | mRNA | ||
AC005223 EMBL· GenBank· DDBJ | AAD10648.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE33250.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY039926 EMBL· GenBank· DDBJ | AAK64030.1 EMBL· GenBank· DDBJ | mRNA | ||
AY079359 EMBL· GenBank· DDBJ | AAL85090.1 EMBL· GenBank· DDBJ | mRNA | ||
AY088606 EMBL· GenBank· DDBJ | AAM66135.1 EMBL· GenBank· DDBJ | mRNA |