Q94AK6 · SAG20_ARATH
- ProteinSenescence associated gene 20
- GeneSAG20
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids110 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Biological Process | leaf senescence | |
Biological Process | response to fungus | |
Biological Process | response to molecule of fungal origin | |
Biological Process | response to nematode | |
Biological Process | response to ozone |
Names & Taxonomy
Protein names
- Recommended nameSenescence associated gene 20
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ94AK6
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000439877 | 1-110 | Senescence associated gene 20 | |||
Sequence: MRVLTGGVSPSSSSFEFVPLSVVSFGSTVIAEGCDAATSISWIHAWTVANGIITQVREYSNTSLTVTRIGNVVAGRRSAEIAPPSHCSSVWESQFSGRAGKPVPGLVLAI |
Proteomic databases
Expression
Induction
Accumulates in leaves during senescence (PubMed:16603661, PubMed:9617813).
Induced reversibly 4 days after exposure to ozone O3 (PubMed:10444084, PubMed:16913859).
Triggered transiently by Nep1, a fungal protein that causes necrosis (PubMed:12857840).
Expressed in nematode-induced giant cells (e.g. M.javanica) at early stages, 3 days after infection (PubMed:20003167).
Induced reversibly 4 days after exposure to ozone O3 (PubMed:10444084, PubMed:16913859).
Triggered transiently by Nep1, a fungal protein that causes necrosis (PubMed:12857840).
Expressed in nematode-induced giant cells (e.g. M.javanica) at early stages, 3 days after infection (PubMed:20003167).
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length110
- Mass (Da)11,464
- Last updated2001-12-01 v1
- ChecksumB545753A1F7CF15B
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009991 EMBL· GenBank· DDBJ | AAF01523.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE74988.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY045972 EMBL· GenBank· DDBJ | AAK76646.1 EMBL· GenBank· DDBJ | mRNA | ||
AY091355 EMBL· GenBank· DDBJ | AAM14294.1 EMBL· GenBank· DDBJ | mRNA | ||
BT000768 EMBL· GenBank· DDBJ | AAN31907.1 EMBL· GenBank· DDBJ | mRNA | ||
AY088170 EMBL· GenBank· DDBJ | AAM67338.1 EMBL· GenBank· DDBJ | mRNA |