Q94899 · CSN2_DROME
- ProteinCOP9 signalosome complex subunit 2
- Genealien
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids444 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COP9 signalosome | |
Cellular Component | cytoplasm | |
Cellular Component | repressor ecdysone receptor complex | |
Molecular Function | nuclear receptor binding | |
Molecular Function | transcription corepressor activity | |
Biological Process | eclosion | |
Biological Process | female germ-line stem cell population maintenance | |
Biological Process | germ cell development | |
Biological Process | germarium-derived cystoblast division | |
Biological Process | male germ-line cyst encapsulation | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | protein deneddylation | |
Biological Process | protein stabilization |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCOP9 signalosome complex subunit 2
- Short namesDch2; Signalosome subunit 2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ94899
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000120974 | 1-444 | COP9 signalosome complex subunit 2 | |||
Sequence: MSDNDDDFMCDDDEDYGLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDLENGEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSASRYNALEKWSNQIQSLQFAVVQKMA |
Proteomic databases
Expression
Tissue specificity
Expressed during embryonic stages 11-14 in the muscle attachment sites (apodemes); pharynx attachment to the roof of the mouth and in the epidermis of the head for the dorsal and ventral prothoracic pharyngeal muscle attachment. From stage 16 onwards expression is seen in all thoracic and abdominal apodemes.
Developmental stage
Expressed both maternally with high levels during oogenesis, and zygotically.
Gene expression databases
Interaction
Subunit
Component of the CSN complex, probably composed of CSN1b, alien/CSN2, CSN3, CSN4, CSN5, CSN6, CSN7 and CSN8. Interacts with Rpn6.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-29 | Acidic residues | ||||
Sequence: MSDNDDDFMCDDDEDYGLEYSEDSNSEPD | ||||||
Region | 1-31 | Disordered | ||||
Sequence: MSDNDDDFMCDDDEDYGLEYSEDSNSEPDVD | ||||||
Domain | 255-417 | PCI | ||||
Sequence: AHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINS |
Sequence similarities
Belongs to the CSN2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length444
- Mass (Da)51,527
- Last updated2003-06-01 v2
- Checksum3E471578DD495B57
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M9PFB5 | M9PFB5_DROME | alien | 444 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-29 | Acidic residues | ||||
Sequence: MSDNDDDFMCDDDEDYGLEYSEDSNSEPD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF129079 EMBL· GenBank· DDBJ | AAD28604.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014134 EMBL· GenBank· DDBJ | AAF52736.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAN10685.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY069836 EMBL· GenBank· DDBJ | AAL39981.1 EMBL· GenBank· DDBJ | mRNA | ||
AY118505 EMBL· GenBank· DDBJ | AAM49874.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
U57758 EMBL· GenBank· DDBJ | AAB49932.1 EMBL· GenBank· DDBJ | mRNA | Frameshift |