Q94420 · MEL26_CAEEL
- ProteinProtein maternal effect lethal 26
- Genemel-26
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids395 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:13679922, PubMed:14528312, PubMed:23918937).
Controls degradation of microtubule severing protein mei-1 after meiosis (PubMed:14528312).
Controls degradation of ppfr-1, the regulatory subunit of PP4 complex, after meiosis (PubMed:23918937).
In body wall muscles, involved in the organization of myosin thick filaments, likely by regulating the degradation of mei-1 downstream of unc-89 (PubMed:22621901).
May also activate the TORC1 pathway (PubMed:29769719).
Controls degradation of microtubule severing protein mei-1 after meiosis (PubMed:14528312).
Controls degradation of ppfr-1, the regulatory subunit of PP4 complex, after meiosis (PubMed:23918937).
In body wall muscles, involved in the organization of myosin thick filaments, likely by regulating the degradation of mei-1 downstream of unc-89 (PubMed:22621901).
May also activate the TORC1 pathway (PubMed:29769719).
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProtein maternal effect lethal 26
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ94420
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with unc-89 to the M line.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown at L1 larval stage results in the disorganization of myosin thick filaments in adult body wall muscles characterized by the formation of abnormal myosin heavy chain myo-3 aggregates and V-shaped crossing of A-bands (PubMed:22621901).
RNAi-mediated knockdown of mel-26 also results in increased lifespan (PubMed:29769719).
RNAi-mediated knockdown of mel-26 also results in increased lifespan (PubMed:29769719).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 94 | Severe loss of interaction with ppfr-1 and mei-1. | ||||
Sequence: C → Y |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000312628 | 1-395 | Protein maternal effect lethal 26 | |||
Sequence: MEPRIDGGVFIGGIGNSGNEMCSNGVPALGVSSQTEIKVEKVQHTWTVKNFSHCYQEYLENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLCLNRVINNNVKAGKIGFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLFPQIMPRDMIIVNVEIDVAVETITTTNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATALLIAADKYRLEELKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILKGHPNLITDIFSQIDRQSSTGATSSVSNLPGVPMDIPGITGNIVPPPSGL |
Proteomic databases
Expression
Interaction
Subunit
Interacts (via BTB domain) with cul-3 (PubMed:13679922, PubMed:14528312, PubMed:22621901).
Seems to be a component of a E3 ubiquitin-protein ligase complex containing cul-3 (PubMed:13679922, PubMed:14528312).
Interacts (probably via MATH domain) with mei-1, which targets mei-1 for ubiquitin-mediated proteolysis (PubMed:14528312, PubMed:22621901, PubMed:23918937).
Interacts (probably via MATH domain) with ppfr-1, the regulatory subunit of the PP4 complex; targets ppfr-1 for ubiquitin-mediated proteolysis (PubMed:23918937).
May interact (via MATH domain) with unc-89 (via Ig-like C2-type domain 2/3 and, Ig-like C2-type domain 50 and fibronectin type-III domain 2) (PubMed:22621901).
Seems to be a component of a E3 ubiquitin-protein ligase complex containing cul-3 (PubMed:13679922, PubMed:14528312).
Interacts (probably via MATH domain) with mei-1, which targets mei-1 for ubiquitin-mediated proteolysis (PubMed:14528312, PubMed:22621901, PubMed:23918937).
Interacts (probably via MATH domain) with ppfr-1, the regulatory subunit of the PP4 complex; targets ppfr-1 for ubiquitin-mediated proteolysis (PubMed:23918937).
May interact (via MATH domain) with unc-89 (via Ig-like C2-type domain 2/3 and, Ig-like C2-type domain 50 and fibronectin type-III domain 2) (PubMed:22621901).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q94420 | C05C10.5 Q09230 | 4 | EBI-320790, EBI-314244 | |
BINARY | Q94420 | CELE_R02F2.5 Q21648 | 3 | EBI-320790, EBI-314179 | |
BINARY | Q94420 | CELE_Y105C5A.1 Q9NF71 | 4 | EBI-320790, EBI-332478 | |
BINARY | Q94420 | cul-3 Q17391 | 3 | EBI-320790, EBI-593075 | |
BINARY | Q94420 | mei-1 P34808 | 6 | EBI-320790, EBI-323248 | |
BINARY | Q94420 | mei-1 P34808-2 | 3 | EBI-320790, EBI-521381 | |
BINARY | Q94420 | mel-26 Q94420 | 7 | EBI-320790, EBI-320790 | |
BINARY | Q94420 | ntl-4 Q9GYQ9 | 3 | EBI-320790, EBI-317604 | |
BINARY | Q94420 | ppfr-1 G5ECH5 | 4 | EBI-320790, EBI-6691815 | |
BINARY | Q94420 | rga-2 Q9XW53 | 3 | EBI-320790, EBI-2421364 | |
BINARY | Q94420 | smo-1 P55853 | 5 | EBI-320790, EBI-313647 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 41-162 | MATH | ||||
Sequence: KVQHTWTVKNFSHCYQEYLENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLCLNRVINNNVKAGKIGFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLFPQIMPRDMIIVNVEI | ||||||
Domain | 201-269 | BTB | ||||
Sequence: CDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDI |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length395
- Mass (Da)44,492
- Last updated2002-06-01 v2
- Checksum3AED944583A155AC
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
K8F7T2 | K8F7T2_CAEEL | mel-26 | 399 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U67737 EMBL· GenBank· DDBJ | AAC63596.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z79759 EMBL· GenBank· DDBJ | CAB02139.2 EMBL· GenBank· DDBJ | Genomic DNA |