Q93Z08 · E136_ARATH
- ProteinGlucan endo-1,3-beta-glucosidase 6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids477 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
Catalytic activity
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 117 | Proton donor | ||||
Sequence: E | ||||||
Active site | 262 | Nucleophile | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Cellular Component | plasmodesma | |
Cellular Component | plastid | |
Cellular Component | side of membrane | |
Molecular Function | glucan endo-1,3-beta-D-glucosidase activity | |
Biological Process | carbohydrate metabolic process | |
Biological Process | defense response |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameGlucan endo-1,3-beta-glucosidase 6
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ93Z08
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MGWGSVLLLLAVALLCQRASS | ||||||
Chain | PRO_0000011892 | 22-455 | Glucan endo-1,3-beta-glucosidase 6 | |||
Sequence: IGANWGTQASHPLPPDIVVRMLRENGIQKVKLFDAEYDTLRALGKSGIEVMVGIPNEMLATLASSLKAAEKWVAKNVSTHISTDNVNIRYVAVGNEPFLSTYNGSYLSTTFPALRNIQIAIIKAGLQNQVKVTCPLNADVYDSSTTFPSGGDFRANIRDLMITIVKFLSENGGPFTVNIYPYISLYTNPDFPVDYAFFDGNAQPLNDGGTFYYNMFDANYDTLVHALEKNGFGNMPIIIGEIGWPTDGDSNANLDYAKKFNQGFMAHISGGKGTPRRPGPIDAYLFSLIDEDAKSVQPGYFERHWGIFTFDGLPKYALNLGTTNTGALIQAKGVRYLERKWCVMKPNVRLDDPQVAPAVSYACSLGDCTSLGVGTSCANLDGKQNISYAFNSYYQIQDQLDTACKFPNISEVTKTDPSTGTCRFPIMIEPYYGG | ||||||
Glycosylation | 97 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 124 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 363↔425 | |||||
Sequence: CVMKPNVRLDDPQVAPAVSYACSLGDCTSLGVGTSCANLDGKQNISYAFNSYYQIQDQLDTAC | ||||||
Glycosylation | 406 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 429 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Lipidation | 455 | GPI-anchor amidated glycine | ||||
Sequence: G | ||||||
Propeptide | PRO_0000011893 | 456-477 | Removed in mature form | |||
Sequence: AAREHGFFFPLLMVAAIAVSIF |
Post-translational modification
Contains two additional disulfide bonds.
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length477
- Mass (Da)52,211
- Last updated2003-10-31 v2
- ChecksumB8FE6F29218DF57C
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 219 | in Ref. 3; AAL24251/AAN18179 | ||||
Sequence: F → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB024029 EMBL· GenBank· DDBJ | BAB11001.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED96996.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY058864 EMBL· GenBank· DDBJ | AAL24251.1 EMBL· GenBank· DDBJ | mRNA | ||
BT000612 EMBL· GenBank· DDBJ | AAN18179.1 EMBL· GenBank· DDBJ | mRNA |