Q93560 · BLMP1_CAEEL
- ProteinB lymphocyte-induced maturation protein 1 homolog
- Geneblmp-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids817 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor which binds to enhancer elements in the promoter region of genes (PubMed:26234645).
Regulates the expression of the transcription factor bed-3 to control vulval development (PubMed:26234645, PubMed:32417234).
Promotes terminal differentiation in the hypodermis and is involved in regulation of gonadal outgrowth and entry into the dauer stage (PubMed:24613396).
Regulates the timing of dorsalward migration of the distal tip cells of the hermaphrodite gonad by inhibiting precocious unc-5 and lin-29 expression which in turn prevents early dorsalward turning (PubMed:24968003).
Plays a role in male tail tip morphogenesis (PubMed:21408209).
Regulates the expression of the transcription factor bed-3 to control vulval development (PubMed:26234645, PubMed:32417234).
Promotes terminal differentiation in the hypodermis and is involved in regulation of gonadal outgrowth and entry into the dauer stage (PubMed:24613396).
Regulates the timing of dorsalward migration of the distal tip cells of the hermaphrodite gonad by inhibiting precocious unc-5 and lin-29 expression which in turn prevents early dorsalward turning (PubMed:24968003).
Plays a role in male tail tip morphogenesis (PubMed:21408209).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription repressor activity, RNA polymerase II-specific | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | cell fate commitment | |
Biological Process | negative regulation of distal tip cell migration | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of apoptotic process involved in development | |
Biological Process | positive regulation of nematode male tail tip morphogenesis | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of nematode larval development, heterochronic | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameB lymphocyte-induced maturation protein 1 homolog
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ93560
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Gonadal migration defects with premature dorsal turning of distal tip cells in the hermaphrodite gonad (PubMed:24613396, PubMed:24968003).
Defective dauer formation, shortened lifespan and retarded terminal differentiation of seam cells with incomplete adult alae synthesis (PubMed:24613396).
Suppresses the precocious seam cell terminal differentiation and gonadal migration defects seen in dre-1 mutants (PubMed:24613396).
Weak dumpy phenotype and partially penetrant embryonic lethality (PubMed:24968003).
Reduced expression of the transcription factor bed-3 which is involved in vulval development and failed division of vulval precursor cell descendents (PubMed:26234645).
RNAi-mediated knockdown impairs the expression of several hypodermis-specific genes; reduces levels of clo-124 mRNA and increases levels of lin-29 mRNA (PubMed:32417234).
RNAi-mediated knockdown results in the precocious onset of tail tip retraction resulting in over-retracted and shortened adult male tails (also known as the Ore phenotype) (PubMed:21408209).
Defective dauer formation, shortened lifespan and retarded terminal differentiation of seam cells with incomplete adult alae synthesis (PubMed:24613396).
Suppresses the precocious seam cell terminal differentiation and gonadal migration defects seen in dre-1 mutants (PubMed:24613396).
Weak dumpy phenotype and partially penetrant embryonic lethality (PubMed:24968003).
Reduced expression of the transcription factor bed-3 which is involved in vulval development and failed division of vulval precursor cell descendents (PubMed:26234645).
RNAi-mediated knockdown impairs the expression of several hypodermis-specific genes; reduces levels of clo-124 mRNA and increases levels of lin-29 mRNA (PubMed:32417234).
RNAi-mediated knockdown results in the precocious onset of tail tip retraction resulting in over-retracted and shortened adult male tails (also known as the Ore phenotype) (PubMed:21408209).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000430670 | 1-817 | B lymphocyte-induced maturation protein 1 homolog | |||
Sequence: MGQGSGDDGVPPAPFSSAAAAAHSPPHSPLSVGVSSASSATSSSSTPPSSTSPAGVSASGARNVETDWKQSGDENLAELCIFHVPDKSVSLPNPKRAECTLPMNLILKSSSKNRKKSSIWSSDHIPRGVRFGPLVGEIRLVDVDTALVCPAEASMAGGGPAQEDVPFDEAPEEWKIYSPSGGRLNKTICVKDDARSNWMKYVAAAEEEDFQNLVAAQIGNDIYFYTVKKIEANTELSFWFSRDYARKLNYSTRPYVRVRRPATQLIPSAPPASASTAIASLAETIVAIDYSVKKLIESPIDTLSTDASSASDEEMIDVEEQESCTRPVAEVTRPNVIQNPVVRPVATKVNNFPGIPVRLGNFYASPLVDFKEFMRKSLQLKLVDTSMFVSPVAQTTAAITATGGRSGQPIDVQPVLAATAGAHFGNYAAIYGSQDFQHELSKPLYTSASPAFGGGGGMGGGFGMGGSAHTSSFHQLPFVNHSSSSHNDSSFNGVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSMRDDLMDIKGEIDEGSMSGSGYGNLGIFENTLNSELKRPLMPIETIYSKYNLPNASLLGQGPSGMQEQQAPPPTSQQQQHMMYGNTMGHMGQGSHLQGPPPPPQHFQMDHSGMQNGGGIPHQHQLIQGGPSSGSGQQQHPQHNGIHRLPDLKNPLLPSLGLPHYP |
Post-translational modification
Ubiquitinated by the SCF(dre-1) complex, leading to its degradation by the proteasome.
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Expressed in hypodermal, vulval, intestinal and distal tip cells.
Developmental stage
In distal tip cells, expressed from mid-L2 when gonadal outgrowth initiates (PubMed:24613396).
By mid-L3, just prior to the dorsal gonadal turn, levels drop dramatically (PubMed:24968003).
In seam and hypodermal cells, levels are largely constant throughout larval development except for a transient peak early in L4 (PubMed:24613396).
By mid-L3, just prior to the dorsal gonadal turn, levels drop dramatically (PubMed:24968003).
In seam and hypodermal cells, levels are largely constant throughout larval development except for a transient peak early in L4 (PubMed:24613396).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-62 | Disordered | ||||
Sequence: MGQGSGDDGVPPAPFSSAAAAAHSPPHSPLSVGVSSASSATSSSSTPPSSTSPAGVSASGAR | ||||||
Compositional bias | 29-62 | Polar residues | ||||
Sequence: PLSVGVSSASSATSSSSTPPSSTSPAGVSASGAR | ||||||
Domain | 103-241 | SET | ||||
Sequence: MNLILKSSSKNRKKSSIWSSDHIPRGVRFGPLVGEIRLVDVDTALVCPAEASMAGGGPAQEDVPFDEAPEEWKIYSPSGGRLNKTICVKDDARSNWMKYVAAAEEEDFQNLVAAQIGNDIYFYTVKKIEANTELSFWFS | ||||||
Zinc finger | 508-530 | C2H2-type 1 | ||||
Sequence: YACKDCNKTFGQLSNLKVHVRTH | ||||||
Zinc finger | 536-558 | C2H2-type 2 | ||||
Sequence: FKCEICTKEFTQLAHLQKHHLVH | ||||||
Zinc finger | 564-586 | C2H2-type 3 | ||||
Sequence: HRCDICDKRFSSTSNLKTHLRLH | ||||||
Zinc finger | 592-614 | C2H2-type 4 | ||||
Sequence: YTCDVCDAKFTQYVHLRLHKRLH | ||||||
Zinc finger | 620-642 | C2H2-type 5; degenerate | ||||
Sequence: YSCGTCGKKYISPSGLRTHWKTT | ||||||
Compositional bias | 709-737 | Polar residues | ||||
Sequence: LLGQGPSGMQEQQAPPPTSQQQQHMMYGN | ||||||
Region | 709-817 | Disordered | ||||
Sequence: LLGQGPSGMQEQQAPPPTSQQQQHMMYGNTMGHMGQGSHLQGPPPPPQHFQMDHSGMQNGGGIPHQHQLIQGGPSSGSGQQQHPQHNGIHRLPDLKNPLLPSLGLPHYP | ||||||
Compositional bias | 769-795 | Polar residues | ||||
Sequence: GGIPHQHQLIQGGPSSGSGQQQHPQHN |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q93560-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length817
- Mass (Da)88,639
- Last updated1997-02-01 v1
- Checksum4B74F5263A9594FA
Q93560-2
- Name2
- Differences from canonical
- 685-700: Missing
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 29-62 | Polar residues | ||||
Sequence: PLSVGVSSASSATSSSSTPPSSTSPAGVSASGAR | ||||||
Alternative sequence | VSP_057061 | 685-700 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 709-737 | Polar residues | ||||
Sequence: LLGQGPSGMQEQQAPPPTSQQQQHMMYGN | ||||||
Compositional bias | 769-795 | Polar residues | ||||
Sequence: GGIPHQHQLIQGGPSSGSGQQQHPQHN |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284601 EMBL· GenBank· DDBJ | CAB01695.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284601 EMBL· GenBank· DDBJ | CAV31771.1 EMBL· GenBank· DDBJ | Genomic DNA |