Q93045 · STMN2_HUMAN
- ProteinStathmin-2
- GeneSTMN2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids179 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulator of microtubule stability. When phosphorylated by MAPK8, stabilizes microtubules and consequently controls neurite length in cortical neurons. In the developing brain, negatively regulates the rate of exit from multipolar stage and retards radial migration from the ventricular zone (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | endosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | growth cone | |
Cellular Component | lamellipodium | |
Cellular Component | membrane | |
Cellular Component | neuron projection | |
Cellular Component | neuronal cell body | |
Cellular Component | perinuclear region of cytoplasm | |
Molecular Function | calcium-dependent protein binding | |
Molecular Function | tubulin binding | |
Biological Process | cellular response to nerve growth factor stimulus | |
Biological Process | microtubule depolymerization | |
Biological Process | negative regulation of microtubule depolymerization | |
Biological Process | negative regulation of microtubule polymerization | |
Biological Process | negative regulation of neuron projection development | |
Biological Process | neuron projection development | |
Biological Process | positive regulation of microtubule depolymerization | |
Biological Process | positive regulation of neuron projection development | |
Biological Process | regulation of microtubule polymerization or depolymerization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameStathmin-2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ93045
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Peripheral membrane protein
Note: Associated with punctate structures in the perinuclear cytoplasm, axons, and growth cones of developing neurons. SCG10 exists in both soluble and membrane-bound forms. Colocalized with CIB1 in neurites of developing hippocampal primary neurons (By similarity).
Colocalized with CIB1 in the cell body, neuritis and growth cones of neurons. Colocalized with CIB1 to the leading edge of lamellipodia
Colocalized with CIB1 in the cell body, neuritis and growth cones of neurons. Colocalized with CIB1 to the leading edge of lamellipodia
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 163 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000182396 | 1-179 | UniProt | Stathmin-2 | |||
Sequence: MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG | |||||||
Modified residue | 16 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Lipidation | 22 | UniProt | S-palmitoyl cysteine | ||||
Sequence: C | |||||||
Lipidation | 24 | UniProt | S-palmitoyl cysteine | ||||
Sequence: C | |||||||
Modified residue | 50 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 62 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 62 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 73 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 80 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 97 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 97 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Sumoylated.
Phosphorylated mostly by MAPK8, but also by MAPK9 and MAPK10 in the developing brain cortex.
N-terminal palmitoylation promotes specific anchoring to the cytosolic leaflet of Golgi membranes and subsequent vesicular trafficking along dendrites and axons. Neuronal Stathmins are substrates for palmitoyltransferases ZDHHC3, ZDHHC7 and ZDHHC15.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Neuron specific.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with MAPK8 (By similarity).
Interacts with ITM2C. Interacts with KIFBP. Interacts (via the N-terminal region) with CIB1 (via C-terminal region); the interaction is direct, occurs in a calcium-dependent manner and attenuates the neurite outgrowth inhibition of STMN2
Interacts with ITM2C. Interacts with KIFBP. Interacts (via the N-terminal region) with CIB1 (via C-terminal region); the interaction is direct, occurs in a calcium-dependent manner and attenuates the neurite outgrowth inhibition of STMN2
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q93045 | CCHCR1 Q8TD31-3 | 3 | EBI-714194, EBI-10175300 | |
BINARY | Q93045 | CIB1 Q99828 | 8 | EBI-714194, EBI-372594 | |
BINARY | Q93045 | CTNNA3 Q9UI47-2 | 3 | EBI-714194, EBI-11962928 | |
BINARY | Q93045 | FAM90A1 Q86YD7 | 3 | EBI-714194, EBI-6658203 | |
BINARY | Q93045 | MBD3 O95983-2 | 3 | EBI-714194, EBI-11978579 | |
BINARY | Q93045 | NTAQ1 Q96HA8 | 3 | EBI-714194, EBI-741158 | |
BINARY | Q93045 | PSMB1 P20618 | 3 | EBI-714194, EBI-372273 | |
BINARY | Q93045 | SESTD1 Q86VW0 | 3 | EBI-714194, EBI-6117072 | |
BINARY | Q93045 | TEX11 Q8IYF3 | 5 | EBI-714194, EBI-742397 | |
BINARY | Q93045 | TEX11 Q8IYF3-3 | 3 | EBI-714194, EBI-11523345 | |
BINARY | Q93045 | TFCP2 Q12800 | 3 | EBI-714194, EBI-717422 | |
BINARY | Q93045 | TXLNA P40222 | 4 | EBI-714194, EBI-359793 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-26 | Membrane attachment | ||||
Sequence: MAKTAMAYKEKMKELSMLSLICSCFY | ||||||
Domain | 38-179 | SLD | ||||
Sequence: DDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG | ||||||
Region | 39-96 | Regulatory/phosphorylation domain | ||||
Sequence: DMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRK | ||||||
Coiled coil | 75-179 | |||||
Sequence: KKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG |
Sequence similarities
Belongs to the stathmin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q93045-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length179
- Mass (Da)20,828
- Last updated2004-08-31 v3
- ChecksumF9A258A1B57E620D
Q93045-2
- Name2
- Differences from canonical
- 161-179: ERHAAEVRRNKELQVELSG → LVKFISSELKESIESQFLELQREGEKQ
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E5RGX5 | E5RGX5_HUMAN | STMN2 | 168 |
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 92 | in Ref. 1; AAB36428 | ||||
Sequence: E → G | ||||||
Sequence conflict | 122 | in Ref. 2; BAA23326 | ||||
Sequence: E → G | ||||||
Alternative sequence | VSP_045047 | 161-179 | in isoform 2 | |||
Sequence: ERHAAEVRRNKELQVELSG → LVKFISSELKESIESQFLELQREGEKQ |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S82024 EMBL· GenBank· DDBJ | AAB36428.1 EMBL· GenBank· DDBJ | mRNA | ||
D50375 EMBL· GenBank· DDBJ | BAA23326.1 EMBL· GenBank· DDBJ | mRNA | ||
BT020034 EMBL· GenBank· DDBJ | AAV38837.1 EMBL· GenBank· DDBJ | mRNA | ||
CR456833 EMBL· GenBank· DDBJ | CAG33114.1 EMBL· GenBank· DDBJ | mRNA | ||
AK292737 EMBL· GenBank· DDBJ | BAF85426.1 EMBL· GenBank· DDBJ | mRNA | ||
AC016240 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC025599 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471068 EMBL· GenBank· DDBJ | EAW87064.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471068 EMBL· GenBank· DDBJ | EAW87065.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC006302 EMBL· GenBank· DDBJ | AAH06302.1 EMBL· GenBank· DDBJ | mRNA | ||
BQ069488 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |