Q92805 · GOGA1_HUMAN
- ProteinGolgin subfamily A member 1
- GeneGOLGA1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids767 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in vesicular trafficking at the Golgi apparatus level. Involved in endosome-to-Golgi trafficking.
Miscellaneous
Antibodies against GOLGA1 are present in sera from patients with Sjoegren syndrome. Sera from patients with Sjoegren syndrome often contain antibodies that react with normal components of the Golgi complex.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acrosomal vesicle | |
Cellular Component | cytosol | |
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi membrane | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | trans-Golgi network |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGolgin subfamily A member 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ92805
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Peripheral membrane protein
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | Loss of TBC1D23-binding. | ||||
Sequence: F → A | ||||||
Mutagenesis | 4 | No effect on TBC1D23-binding. | ||||
Sequence: K → A | ||||||
Mutagenesis | 5 | Loss of TBC1D23-binding. | ||||
Sequence: L → A | ||||||
Mutagenesis | 6 | Decreased TBC1D23-binding. | ||||
Sequence: K → A | ||||||
Mutagenesis | 7 | No effect on TBC1D23-binding. | ||||
Sequence: K → A | ||||||
Mutagenesis | 8 | No effect on TBC1D23-binding. | ||||
Sequence: K → A | ||||||
Mutagenesis | 9 | Decreased TBC1D23-binding. | ||||
Sequence: I → A | ||||||
Mutagenesis | 11 | No effect on TBC1D23-binding. | ||||
Sequence: E → A | ||||||
Mutagenesis | 12 | No effect on TBC1D23-binding. | ||||
Sequence: E → A | ||||||
Natural variant | VAR_047842 | 220 | in dbSNP:rs35237091 | |||
Sequence: N → S | ||||||
Natural variant | VAR_047843 | 317 | in dbSNP:rs583134 | |||
Sequence: L → V | ||||||
Natural variant | VAR_047844 | 425 | in dbSNP:rs634710 | |||
Sequence: T → M | ||||||
Mutagenesis | 695 | No effect on RAB6A-binding, nor on targeting to the Golgi apparatus. | ||||
Sequence: F → A | ||||||
Mutagenesis | 696 | No effect on RAB6A-binding, nor on targeting to the Golgi apparatus. | ||||
Sequence: E → A | ||||||
Mutagenesis | 697 | Loss of RAB6A-binding and of targeting to the Golgi apparatus. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 698 | No effect on RAB6A-binding, nor on targeting to the Golgi apparatus. | ||||
Sequence: L → A | ||||||
Mutagenesis | 742 | No effect on subcellular localization at the Golgi apparatus. | ||||
Sequence: M → A | ||||||
Mutagenesis | 743 | No effect on subcellular localization at the Golgi apparatus, small decrease in RAB6A-binding. | ||||
Sequence: S → A | ||||||
Mutagenesis | 744 | Drastically reduced targeting to the Golgi apparatus, small decrease in RAB6A-binding. | ||||
Sequence: W → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 759 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000190052 | 1-767 | UniProt | Golgin subfamily A member 1 | |||
Sequence: MFAKLKKKIAEETAVAQRPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQANRAKMAEGLALALARKDQEWSEKMDQLEKEKNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQELSKIKHMLLKKEESLGKMEQELEARTRELSRTQEELMNSNQMSSDLSQKLEELQRHYSTLEEQRDHVIASKTGAESKITALEQKEQELQALIQQLSIDLQKVTAETQEKEDVITHLQEKVASLEKRLEQNLSGEEHLQELLKEKTLAEQNLEDTRQQLLAARSSQAKAINTLETRVRELEQTLQASEEQLQQSKGIVAAQETQIQELAAANQESSHVQQQALALEQQFLERTQALEAQIVALERTRAADQTTAEQGMRQLEQENAALKECRNEYERSLQNHQFELKKLKEEWSQREIVSVAMAQALEEVRKQREEFQQQAANLTAIIDEKEQNLREKTEVLLQKEQEILQLERGHNSALLQIHQLQAELEALRTLKAEEAAVVAEQEDLLRLRGPLQAEALSVNESHVTSRAMQDPVFQLPTAGRTPNGEVGAMDLTQLQKEKQDLEQQLLEKNKTIKQMQQRMLELRKTLQKELKIRPDNELFEVREKPGPEMANMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSKPAPKGSIRPSISNPRIPWS | |||||||
Modified residue | 30 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 30 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 33 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 36 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 36 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 41 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 41 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 47 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 50 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 51 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 160 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 194 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 606 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 760 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with RAB6A (PubMed:10209123).
Directly interacts with TBC1D23 (PubMed:29084197).
Interacts with FAM91A1; this interaction may be mediated by TBC1D23 (PubMed:29084197).
Directly interacts with TBC1D23 (PubMed:29084197).
Interacts with FAM91A1; this interaction may be mediated by TBC1D23 (PubMed:29084197).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 13-58 | Disordered | ||||
Sequence: TAVAQRPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSS | ||||||
Coiled coil | 50-657 | |||||
Sequence: SSSREDLSSQLLRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQANRAKMAEGLALALARKDQEWSEKMDQLEKEKNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQELSKIKHMLLKKEESLGKMEQELEARTRELSRTQEELMNSNQMSSDLSQKLEELQRHYSTLEEQRDHVIASKTGAESKITALEQKEQELQALIQQLSIDLQKVTAETQEKEDVITHLQEKVASLEKRLEQNLSGEEHLQELLKEKTLAEQNLEDTRQQLLAARSSQAKAINTLETRVRELEQTLQASEEQLQQSKGIVAAQETQIQELAAANQESSHVQQQALALEQQFLERTQALEAQIVALERTRAADQTTAEQGMRQLEQENAALKECRNEYERSLQNHQFELKKLKEEWSQREIVSVAMAQALEEVRKQREEFQQQAANLTAIIDEKEQNLREKTEVLLQKEQEILQLERGHNSALLQIHQLQAELEALRTLKAEEAAVVAEQEDLLRLRGPLQAEALSVNESHVTSRAMQDPVFQLPTAGRTPNGEVGAMDLTQLQKEKQDLEQQLLEKNKTIKQMQQRMLELRKTLQKELKI | ||||||
Domain | 688-737 | GRIP | ||||
Sequence: TDAREINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKET | ||||||
Region | 748-767 | Disordered | ||||
Sequence: KPAPKGSIRPSISNPRIPWS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length767
- Mass (Da)88,184
- Last updated2010-11-02 v3
- Checksum8E235EAA92D6C61F
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U51587 EMBL· GenBank· DDBJ | AAB81549.1 EMBL· GenBank· DDBJ | mRNA | ||
AL451125 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL354928 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC032853 EMBL· GenBank· DDBJ | AAH32853.1 EMBL· GenBank· DDBJ | mRNA |