Q92544 · TM9S4_HUMAN
- ProteinTransmembrane 9 superfamily member 4
- GeneTM9SF4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids642 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Associates with proteins harboring glycine-rich transmembrane domains and ensures their efficient localization to the cell surface (PubMed:25999474).
Regulates the assembly and activity of V-ATPase in colon cancer cells via its interaction with V-type proton ATPase subunit H (ATP6V1H) and contributes to V-ATPase-mediated pH alterations in cancer cells which play an important role in drug resistance and invasiveness of colon cancer cells (PubMed:25659576).
Plays an important role in an atypical phagocytic activity of metastatic melanoma cells called cannibalism and is involved in the pH regulation of the intracellular vesicles in tumor cells (PubMed:19893578).
Regulates the assembly and activity of V-ATPase in colon cancer cells via its interaction with V-type proton ATPase subunit H (ATP6V1H) and contributes to V-ATPase-mediated pH alterations in cancer cells which play an important role in drug resistance and invasiveness of colon cancer cells (PubMed:25659576).
Plays an important role in an atypical phagocytic activity of metastatic melanoma cells called cannibalism and is involved in the pH regulation of the intracellular vesicles in tumor cells (PubMed:19893578).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | early endosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | membrane | |
Biological Process | cell adhesion | |
Biological Process | phagocytosis | |
Biological Process | positive regulation of protein exit from endoplasmic reticulum | |
Biological Process | positive regulation of protein localization to cell surface | |
Biological Process | protein localization to membrane | |
Biological Process | regulation of intracellular pH | |
Biological Process | response to hypoxia | |
Biological Process | vacuolar proton-transporting V-type ATPase complex assembly |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameTransmembrane 9 superfamily member 4
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ92544
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 24-281 | Extracellular | ||||
Sequence: FYVPGVAPINFHQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQSNKPVTLTVEQSRLVAERITEDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSCTLPEGTNSSPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHWF | ||||||
Transmembrane | 282-302 | Helical | ||||
Sequence: SIINSVVVVFFLSGILSMIII | ||||||
Topological domain | 303-346 | Cytoplasmic | ||||
Sequence: RTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSS | ||||||
Transmembrane | 347-367 | Helical | ||||
Sequence: LLGSGIQLFCMILIVIFVAML | ||||||
Topological domain | 368-376 | Extracellular | ||||
Sequence: GMLSPSSRG | ||||||
Transmembrane | 377-397 | Helical | ||||
Sequence: ALMTTACFLFMFMGVFGGFSA | ||||||
Topological domain | 398-416 | Cytoplasmic | ||||
Sequence: GRLYRTLKGHRWKKGAFCT | ||||||
Transmembrane | 417-437 | Helical | ||||
Sequence: ATLYPGVVFGICFVLNCFIWG | ||||||
Topological domain | 438-449 | Extracellular | ||||
Sequence: KHSSGAVPFPTM | ||||||
Transmembrane | 450-470 | Helical | ||||
Sequence: VALLCMWFGISLPLVYLGYYF | ||||||
Topological domain | 471-501 | Cytoplasmic | ||||
Sequence: GFRKQPYDNPVRTNQIPRQIPEQRWYMNRFV | ||||||
Transmembrane | 502-522 | Helical | ||||
Sequence: GILMAGILPFGAMFIELFFIF | ||||||
Topological domain | 523-535 | Extracellular | ||||
Sequence: SAIWENQFYYLFG | ||||||
Transmembrane | 536-556 | Helical | ||||
Sequence: FLFLVFIILVVSCSQISIVMV | ||||||
Topological domain | 557-570 | Cytoplasmic | ||||
Sequence: YFQLCAEDYRWWWR | ||||||
Transmembrane | 571-591 | Helical | ||||
Sequence: NFLVSGGSAFYVLVYAIFYFV | ||||||
Topological domain | 592-598 | Extracellular | ||||
Sequence: NKLDIVE | ||||||
Transmembrane | 599-619 | Helical | ||||
Sequence: FIPSLLYFGYTALMVLSFWLL | ||||||
Topological domain | 620-642 | Cytoplasmic | ||||
Sequence: TGTIGFYAAYMFVRKIYAAVKID |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 492 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MATAMDWLPWSLLLFSLMCETSA | ||||||
Chain | PRO_0000210178 | 24-642 | Transmembrane 9 superfamily member 4 | |||
Sequence: FYVPGVAPINFHQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQSNKPVTLTVEQSRLVAERITEDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSCTLPEGTNSSPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHWFSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID | ||||||
Modified residue | 312 | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in metastatic melanoma cells whereas it is undetectable in primary melanoma cells, healthy skin tissues and peripheral blood lymphocytes. Expressed in CD34+ hematopoietic progenitor cells and during monocyte and granulocyte differentiation. Overexpressed in acute myeloid leukemia, in particular in those displaying granulocytic differentiation (at protein level).
Induction
Transcriptionally repressed following hypoxia by HIF1A in leukemic cells.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with ATP6V1H in colon cancer cells (PubMed:25659576).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q92544 | F3 P13726 | 2 | EBI-6138615, EBI-1040727 | |
BINARY | Q92544 | MTOR P42345 | 4 | EBI-6138615, EBI-359260 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length642
- Mass (Da)74,519
- Last updated2008-02-26 v2
- Checksum91E8F925D64A5AE7
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0C4DFM1 | A0A0C4DFM1_HUMAN | TM9SF4 | 625 | ||
F2Z2L1 | F2Z2L1_HUMAN | TM9SF4 | 85 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D87444 EMBL· GenBank· DDBJ | BAA13385.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AL049539 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471077 EMBL· GenBank· DDBJ | EAW76391.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC021107 EMBL· GenBank· DDBJ | AAH21107.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC022850 EMBL· GenBank· DDBJ | AAH22850.2 EMBL· GenBank· DDBJ | mRNA |