Q924A0 · TF7L2_MOUSE
- ProteinTranscription factor 7-like 2
- GeneTcf7l2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids459 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as a repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif CCTTTGATC in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1 (By similarity).
Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine
Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 327-395 | HMG box | ||||
Sequence: IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWS |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor 7-like 2
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ924A0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Diffuse pattern. Colocalizes with SUMO1 and PIAS4 in a subset of PML (promyelocytic leukemia) nuclear bodies (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Involvement in disease
PTM/Processing
Features
Showing features for chain, cross-link, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000048624 | 1-459 | Transcription factor 7-like 2 | |||
Sequence: MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQDSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTYLQMKWPLLDVQAGSLQSRQTLKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCSL | ||||||
Cross-link | 22 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 178 | Phosphothreonine; by NLK | ||||
Sequence: T | ||||||
Modified residue | 189 | Phosphothreonine; by NLK | ||||
Sequence: T | ||||||
Cross-link | 297 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K |
Post-translational modification
Phosphorylated at Thr-178 and/or Thr-189 by NLK. Phosphorylation by NLK at these sites inhibits DNA-binding by TCF7L2/TCF4, thereby preventing transcriptional activation of target genes of the canonical Wnt/beta-catenin signaling pathway (By similarity).
Polysumoylated. Sumoylation is enhanced by PIAS family members and desumoylation is enhanced by SENP2. Sumoylation/desumoylation regulates TCF7L2/TCF4 transcription activity in the Wnt/beta-catenin signaling pathway without altering interaction with CTNNB1 nor binding to DNA (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in adult brain and liver, and at lower levels in intestine, with a clear increase from the distal colon to the duodenum. Detected at low levels in heart, lung, kidney, pituitary and testis.
Developmental stage
First detected at 10.5 dpc. Highly expressed at 13.5 dpc-16.5 dpc in the central nervous system, in particular in the roof of the mesencephalon, at the ditelencephalic junction and in dorsal thalamus. At 13.5 dpc, detected at low levels in gastrointestinal epithelia.
Gene expression databases
Interaction
Subunit
Interacts with TGFB1I1 (PubMed:16291758).
Interacts with SPIN1 (By similarity).
Interacts with CTNNB1 (via the armadillo repeat); forms stable transcription complex (PubMed:19816403).
Interacts with EP300. Interacts with NLK. Interacts with CCDC85B (probably through the HMG box); prevents interaction with CTNNB1 (By similarity).
Interacts with TNIK (PubMed:19816403).
Interacts with MAD2L2; prevents TCF7L2/TCF4 binding to promZIPK/DAPK3oters, negatively modulating its transcriptional activity. Interacts with ZIPK/DAPK3. Interacts with XIAP/BIRC4 and TLE3. Interacts with DDIT3/CHOP. The CTNNB1 and TCF7L2/TCF4 complex interacts with PML (isoform PML-4).
Identified in a complex with CTNNB1 and FERMT2. Interacts with C11orf84/SPINDOC in a SPIN1-dependent manner (By similarity).
Interacts with DAZAP2; the interaction results in localization of DAZAP2 to the nucleus (By similarity).
Interacts with SPIN1 (By similarity).
Interacts with CTNNB1 (via the armadillo repeat); forms stable transcription complex (PubMed:19816403).
Interacts with EP300. Interacts with NLK. Interacts with CCDC85B (probably through the HMG box); prevents interaction with CTNNB1 (By similarity).
Interacts with TNIK (PubMed:19816403).
Interacts with MAD2L2; prevents TCF7L2/TCF4 binding to promZIPK/DAPK3oters, negatively modulating its transcriptional activity. Interacts with ZIPK/DAPK3. Interacts with XIAP/BIRC4 and TLE3. Interacts with DDIT3/CHOP. The CTNNB1 and TCF7L2/TCF4 complex interacts with PML (isoform PML-4).
Identified in a complex with CTNNB1 and FERMT2. Interacts with C11orf84/SPINDOC in a SPIN1-dependent manner (By similarity).
Interacts with DAZAP2; the interaction results in localization of DAZAP2 to the nucleus (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q924A0 | Hic1 Q9R1Y5 | 4 | EBI-646713, EBI-5236187 | |
BINARY | Q924A0 | Traf1 P39428 | 6 | EBI-646713, EBI-520123 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-53 | CTNNB1-binding | ||||
Sequence: MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESE | ||||||
Region | 1-96 | Disordered | ||||
Sequence: MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQDSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFK | ||||||
Compositional bias | 16-46 | Basic and acidic residues | ||||
Sequence: DELISFKDEGEQEEKNSENSSAERDLADVKS | ||||||
Compositional bias | 59-91 | Basic and acidic residues | ||||
Sequence: SSDSEAERRPPPRSESFRDKSRESLEEAAKRQD | ||||||
Region | 178-372 | Mediates interaction with MAD2L2 | ||||
Sequence: TPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREE | ||||||
Compositional bias | 295-309 | Polar residues | ||||
Sequence: TVKQESSQSDVGSLH | ||||||
Region | 295-327 | Disordered | ||||
Sequence: TVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI | ||||||
Compositional bias | 310-327 | Basic and acidic residues | ||||
Sequence: SSKHQDSKKEEEKKKPHI | ||||||
Region | 397-418 | Disordered | ||||
Sequence: RDNYGKKKKRKRDKQPGETNEH | ||||||
Motif | 402-408 | Nuclear localization signal | ||||
Sequence: KKKKRKR |
Sequence similarities
Belongs to the TCF/LEF family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 9 isoforms produced by Alternative splicing.
Q924A0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length459
- Mass (Da)51,217
- Last updated2003-03-25 v2
- Checksum43BC307DC258E83F
Q924A0-2
- Name2
Q924A0-3
- Name3
- Differences from canonical
- 237-240: Missing
Q924A0-4
- Name4
Q924A0-5
- Name5
Q924A0-6
- Name6
- Differences from canonical
- 270-459: Missing
Q924A0-7
- Name7
Q924A0-8
- Name8
- NoteMay result from the retention of an intron in the cDNA.
Q924A0-9
- Name9
- SynonymsdnTcf7l2 exon1b/c
- NoteDominant negative form which cannot bind CTNNB1. Expression is VAX2-dependent.
- Differences from canonical
- 1-161: MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQDSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTYLQMKWPLLDVQAGSLQSRQTLKDARSPSPAHIV → M
Computationally mapped potential isoform sequences
There are 10 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F6XQR1 | F6XQR1_MOUSE | Tcf7l2 | 477 | ||
E9Q990 | E9Q990_MOUSE | Tcf7l2 | 435 | ||
A0A0R4J1G0 | A0A0R4J1G0_MOUSE | Tcf7l2 | 447 | ||
D3YWT3 | D3YWT3_MOUSE | Tcf7l2 | 442 | ||
F6WPX2 | F6WPX2_MOUSE | Tcf7l2 | 442 | ||
D3Z1L0 | D3Z1L0_MOUSE | Tcf7l2 | 275 | ||
D3Z002 | D3Z002_MOUSE | Tcf7l2 | 178 | ||
F6WBK9 | F6WBK9_MOUSE | Tcf7l2 | 459 | ||
E9QQ90 | E9QQ90_MOUSE | Tcf7l2 | 598 | ||
E9QQ91 | E9QQ91_MOUSE | Tcf7l2 | 459 |
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_043205 | 1-161 | in isoform 9 | |||
Sequence: MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQDSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTYLQMKWPLLDVQAGSLQSRQTLKDARSPSPAHIV → M | ||||||
Compositional bias | 16-46 | Basic and acidic residues | ||||
Sequence: DELISFKDEGEQEEKNSENSSAERDLADVKS | ||||||
Sequence conflict | 57 | in Ref. 2; AAD16967 and 3; AAK77488/AAK77489/AAK77490 | ||||
Sequence: D → N | ||||||
Compositional bias | 59-91 | Basic and acidic residues | ||||
Sequence: SSDSEAERRPPPRSESFRDKSRESLEEAAKRQD | ||||||
Alternative sequence | VSP_006973 | 127 | in isoform 7 | |||
Sequence: T → TLHFQSGSTHYSAYKTIEHQIAIQ | ||||||
Alternative sequence | VSP_006974 | 161 | in isoform 5 | |||
Sequence: V → VQSPLPCCTQGHACPHFYTPSDFTVSTQVFRDTKSSHSLQKVGEPWYLE | ||||||
Sequence conflict | 236 | in Ref. 4; AAL58534 | ||||
Sequence: W → R | ||||||
Alternative sequence | VSP_006975 | 237-240 | in isoform 3 and isoform 7 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_006976 | 268 | in isoform 2 and isoform 8 | |||
Sequence: S → SSFLSS | ||||||
Alternative sequence | VSP_006977 | 270-459 | in isoform 5, isoform 6 and isoform 7 | |||
Sequence: Missing | ||||||
Compositional bias | 295-309 | Polar residues | ||||
Sequence: TVKQESSQSDVGSLH | ||||||
Compositional bias | 310-327 | Basic and acidic residues | ||||
Sequence: SSKHQDSKKEEEKKKPHI | ||||||
Sequence conflict | 410 | in Ref. 2; AAD16968 | ||||
Sequence: K → Q | ||||||
Alternative sequence | VSP_006978 | 417-433 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_006979 | 417-459 | in isoform 2 | |||
Sequence: EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCSL → GEKKSAFATYKVKAAASAHPLQMEAY | ||||||
Alternative sequence | VSP_006980 | 417-459 | in isoform 8 | |||
Sequence: EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCSL → GERGESGRWRLEDHSYVRLPSGGGRRNPRPGHCGEPILGSLFCLCVF | ||||||
Alternative sequence | VSP_006981 | 457-459 | in isoform 4 | |||
Sequence: CSL → ADANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPHLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEAAHGKASALCPNGALDLPPAALQPSMVPSSSLAQPSTSSLHSHNSLAGTQPQPLSLVTKSLE |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ223070 EMBL· GenBank· DDBJ | CAA11071.1 EMBL· GenBank· DDBJ | mRNA | ||
AF107298 EMBL· GenBank· DDBJ | AAD16967.1 EMBL· GenBank· DDBJ | mRNA | ||
AF107299 EMBL· GenBank· DDBJ | AAD16968.1 EMBL· GenBank· DDBJ | mRNA | ||
AF363722 EMBL· GenBank· DDBJ | AAK77485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF363722 EMBL· GenBank· DDBJ | AAK77486.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF363724 EMBL· GenBank· DDBJ | AAK77488.1 EMBL· GenBank· DDBJ | mRNA | ||
AF363725 EMBL· GenBank· DDBJ | AAK77489.1 EMBL· GenBank· DDBJ | mRNA | ||
AF363726 EMBL· GenBank· DDBJ | AAK77490.1 EMBL· GenBank· DDBJ | mRNA | ||
AY072035 EMBL· GenBank· DDBJ | AAL58534.1 EMBL· GenBank· DDBJ | mRNA | ||
AK048536 EMBL· GenBank· DDBJ | BAC33366.1 EMBL· GenBank· DDBJ | mRNA | ||
AC118695 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC137148 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC157916 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |