Q923D5 · WBP11_MOUSE
- ProteinWW domain-binding protein 11
- GeneWbp11
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids641 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Activates pre-mRNA splicing. May inhibit PP1 phosphatase activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nuclear speck | |
Cellular Component | nucleus | |
Molecular Function | protein phosphatase regulator activity | |
Biological Process | mRNA processing | |
Biological Process | RNA splicing | |
Biological Process | rRNA processing |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameWW domain-binding protein 11
- Short namesWBP-11
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ923D5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Predominantly located in the nucleus with granular heterogeneous distribution. Excluded from nucleoli in interphase cells, distributed throughout cytoplasm in dividing cells. Colocalized with SC35 and U2B in the nucleus. In the cytoplasm, associates with the intermediate filament protein vimentin.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mutant embryos die prior to 8.5 dpc (PubMed:33276377).
Heterozygous null mice are small and exhibit defects in axial skeleton, kidneys and esophagus (PubMed:33276377).
Heterozygous null mice are small and exhibit defects in axial skeleton, kidneys and esophagus (PubMed:33276377).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 219 | Impairs interaction with PP1; when associated with A-221. | ||||
Sequence: V → A | ||||||
Mutagenesis | 221 | Impairs interaction with PP1; when associated with A-219. | ||||
Sequence: F → A | ||||||
Mutagenesis | 308 | Impairs interaction with PP1; when associated with A-310. | ||||
Sequence: V → A | ||||||
Mutagenesis | 310 | Impairs interaction with PP1; when associated with A-308. | ||||
Sequence: F → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 60 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000065946 | 1-641 | WW domain-binding protein 11 | |||
Sequence: MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPARAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVLQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDMSSTSEDDGYPEDMDQDKHDDSTEDSDTDRSDAESDGDEFGHREDSERDNTEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEEEDADDSDDSEAEKQSQKQHKDDGHSDSTAAASSQQQAPPQSAPASQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPSLIQRPKADDASAATIEKKATATISAKPQITNPKAEVTRFVPTALRVRRENKGATAVPQRRSEDDSAVPVAKAAPRSGPSVAVSVQTKDDVYEAFMKEMEGLL | ||||||
Modified residue | 13 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 181 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 192 | Omega-N-methylarginine | ||||
Sequence: R | ||||||
Modified residue | 236 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 237 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 279 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 283 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 353 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 361 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 364 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 557 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 565 | N6-acetyllysine | ||||
Sequence: K | ||||||
Cross-link | 572 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 600 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitously expressed, with highest levels in testis.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, coiled coil, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MGRRSTSSTKSGKFMN | ||||||
Region | 1-37 | Disordered | ||||
Sequence: MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQR | ||||||
Region | 1-45 | Required for nuclear import | ||||
Sequence: MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVL | ||||||
Coiled coil | 75-133 | |||||
Sequence: EKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQH | ||||||
Region | 188-213 | Disordered | ||||
Sequence: HGVPRLPPGRKPPGPPPGPPPPQVLQ | ||||||
Compositional bias | 193-211 | Pro residues | ||||
Sequence: LPPGRKPPGPPPGPPPPQV | ||||||
Region | 217-221 | Interaction with PP1 | ||||
Sequence: RKVGF | ||||||
Compositional bias | 236-252 | Basic and acidic residues | ||||
Sequence: YSPELAQRGHDDDMSST | ||||||
Region | 236-550 | Disordered | ||||
Sequence: YSPELAQRGHDDDMSSTSEDDGYPEDMDQDKHDDSTEDSDTDRSDAESDGDEFGHREDSERDNTEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEEEDADDSDDSEAEKQSQKQHKDDGHSDSTAAASSQQQAPPQSAPASQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPSLIQRPKADDAS | ||||||
Compositional bias | 283-319 | Basic and acidic residues | ||||
Sequence: SDGDEFGHREDSERDNTEEKKSGLSVRFADMPGKSRK | ||||||
Region | 306-310 | Interaction with PP1 | ||||
Sequence: LSVRF | ||||||
Compositional bias | 347-364 | Acidic residues | ||||
Sequence: REVEEFSEEEDADDSDDS | ||||||
Compositional bias | 365-381 | Basic and acidic residues | ||||
Sequence: EAEKQSQKQHKDDGHSD | ||||||
Compositional bias | 382-398 | Polar residues | ||||
Sequence: STAAASSQQQAPPQSAP | ||||||
Compositional bias | 399-534 | Pro residues | ||||
Sequence: ASQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVL | ||||||
Motif | 455-466 | PGR | ||||
Sequence: PRLLPPGPPPGR | ||||||
Region | 588-620 | Disordered | ||||
Sequence: ENKGATAVPQRRSEDDSAVPVAKAAPRSGPSVA | ||||||
Region | 633-641 | Required for nuclear export | ||||
Sequence: FMKEMEGLL |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length641
- Mass (Da)69,875
- Last updated2005-09-13 v2
- Checksum9C97281B4257B1F6
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0N4SVL7 | A0A0N4SVL7_MOUSE | Wbp11 | 32 | ||
A0A0N4SV69 | A0A0N4SV69_MOUSE | Wbp11 | 143 | ||
A0A0N4SWF7 | A0A0N4SWF7_MOUSE | Wbp11 | 194 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MGRRSTSSTKSGKFMN | ||||||
Compositional bias | 193-211 | Pro residues | ||||
Sequence: LPPGRKPPGPPPGPPPPQV | ||||||
Compositional bias | 236-252 | Basic and acidic residues | ||||
Sequence: YSPELAQRGHDDDMSST | ||||||
Compositional bias | 283-319 | Basic and acidic residues | ||||
Sequence: SDGDEFGHREDSERDNTEEKKSGLSVRFADMPGKSRK | ||||||
Compositional bias | 347-364 | Acidic residues | ||||
Sequence: REVEEFSEEEDADDSDDS | ||||||
Compositional bias | 365-381 | Basic and acidic residues | ||||
Sequence: EAEKQSQKQHKDDGHSD | ||||||
Sequence conflict | 378 | in Ref. 2; AAH06600 and 3; AAC34812 | ||||
Sequence: G → A | ||||||
Compositional bias | 382-398 | Polar residues | ||||
Sequence: STAAASSQQQAPPQSAP | ||||||
Compositional bias | 399-534 | Pro residues | ||||
Sequence: ASQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK031678 EMBL· GenBank· DDBJ | BAC27508.1 EMBL· GenBank· DDBJ | mRNA | ||
AK041079 EMBL· GenBank· DDBJ | BAC30812.1 EMBL· GenBank· DDBJ | mRNA | ||
AK144968 EMBL· GenBank· DDBJ | BAE26160.1 EMBL· GenBank· DDBJ | mRNA | ||
BC006600 EMBL· GenBank· DDBJ | AAH06600.1 EMBL· GenBank· DDBJ | mRNA | ||
BC021823 EMBL· GenBank· DDBJ | AAH21823.1 EMBL· GenBank· DDBJ | mRNA | ||
AF071186 EMBL· GenBank· DDBJ | AAC34812.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |