Q920Q0 · PALM_RAT
- ProteinParalemmin-1
- GenePalm
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids383 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in plasma membrane dynamics and cell process formation. Necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameParalemmin-1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ920Q0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor
Cell projection, filopodium membrane ; Lipid-anchor
Basolateral cell membrane ; Lipid-anchor
Apicolateral cell membrane ; Lipid-anchor
Note: Translocation to the plasma membrane is enhanced upon stimulation of neuronal activity.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for modified residue, chain, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000411054 | 1-380 | Paralemmin-1 | |||
Sequence: MEVLATDTVSQQERLQAIAEKRRKQAEIESKRRQLEDDRRQLQYLKSKALRERWLLEGTPSSASEGDEDMRKQMQEDEQKARSLEESITRLEKEIDVLEFGESAPAAPKENSAAPSPIRPHSTSPAKEEQKSETMVNAQQTPLGTPKENRKSTPVRSPGGSTMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRDPLPQGVKVYEDETKVVHAVDGLSENGIQPLSSSEVDELIHKADEVTLSEAGSTTGPAEPRGLAEDVTRTTPSRREITGVEAQPGEATSGPPGIQPGQEPPVTMVFMGYQNVEDEAETKKVLGLQDTIKAELVVIEDSVTPREPAPLNGSAAELPATKEENQTGPTTTPSDTQDLDMKKPRCRCC | ||||||
Modified residue | 116 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 122 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 124 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 141 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 145 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 153 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 157 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 161 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 242 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 244 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 345 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 361 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 362 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 363 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 365 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 367 | Phosphothreonine | ||||
Sequence: T | ||||||
Lipidation | 377 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 379 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Modified residue | 380 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 380 | S-farnesyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000411055 | 381-383 | Removed in mature form | |||
Sequence: SVM |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in neurons cells of neuropil-rich areas of the brain, in the Purkinje cells of the cerebellum, in cells of the cerebral cortex, hippocampus, brainstem nuclei and glial processes and sheaths. Expressed in the medulla of the adrenal chromaffin cells and renal duct cells (at protein level).
Developmental stage
Expressed in pyramidal neurons of the hippocampus at 18 dpc.
Gene expression databases
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 7-101 | |||||
Sequence: DTVSQQERLQAIAEKRRKQAEIESKRRQLEDDRRQLQYLKSKALRERWLLEGTPSSASEGDEDMRKQMQEDEQKARSLEESITRLEKEIDVLEFG | ||||||
Region | 51-164 | Disordered | ||||
Sequence: RERWLLEGTPSSASEGDEDMRKQMQEDEQKARSLEESITRLEKEIDVLEFGESAPAAPKENSAAPSPIRPHSTSPAKEEQKSETMVNAQQTPLGTPKENRKSTPVRSPGGSTMM | ||||||
Compositional bias | 64-99 | Basic and acidic residues | ||||
Sequence: SEGDEDMRKQMQEDEQKARSLEESITRLEKEIDVLE | ||||||
Compositional bias | 129-159 | Polar residues | ||||
Sequence: EQKSETMVNAQQTPLGTPKENRKSTPVRSPG | ||||||
Region | 242-293 | Disordered | ||||
Sequence: TLSEAGSTTGPAEPRGLAEDVTRTTPSRREITGVEAQPGEATSGPPGIQPGQ | ||||||
Region | 333-374 | Disordered | ||||
Sequence: SVTPREPAPLNGSAAELPATKEENQTGPTTTPSDTQDLDMKK | ||||||
Compositional bias | 350-368 | Polar residues | ||||
Sequence: PATKEENQTGPTTTPSDTQ |
Sequence similarities
Belongs to the paralemmin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length383
- Mass (Da)41,927
- Last updated2001-12-01 v1
- Checksum8D3878AACD02F953
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6AJZ7 | A0A8I6AJZ7_RAT | Palm | 176 | ||
A0A8I6AUR8 | A0A8I6AUR8_RAT | Palm | 383 | ||
A0A8I6G597 | A0A8I6G597_RAT | Palm | 386 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 64-99 | Basic and acidic residues | ||||
Sequence: SEGDEDMRKQMQEDEQKARSLEESITRLEKEIDVLE | ||||||
Compositional bias | 129-159 | Polar residues | ||||
Sequence: EQKSETMVNAQQTPLGTPKENRKSTPVRSPG | ||||||
Compositional bias | 350-368 | Polar residues | ||||
Sequence: PATKEENQTGPTTTPSDTQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB058889 EMBL· GenBank· DDBJ | BAB68565.1 EMBL· GenBank· DDBJ | mRNA | ||
CH474029 EMBL· GenBank· DDBJ | EDL89390.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC072525 EMBL· GenBank· DDBJ | AAH72525.1 EMBL· GenBank· DDBJ | mRNA |