Q91ZR5 · CTSR1_MOUSE
- ProteinCation channel sperm-associated protein 1
- GeneCatsper1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids686 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Pore-forming subunit of the CatSper complex, a sperm-specific voltage-gated calcium channel that plays a central role in sperm cell hyperactivation. Controls calcium entry to mediate the hyperactivated motility, a step needed for sperm motility which is essential late in the preparation of sperm for fertilization.
Catalytic activity
- Ca2+(in) = Ca2+(out)
Activity regulation
Activated by intracellular alkalinization (By similarity).
In contrast to the human ortholog, not activated by progesterone (PubMed:21412339).
In contrast to the human ortholog, not activated by progesterone (PubMed:21412339).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | CatSper complex | |
Cellular Component | plasma membrane | |
Cellular Component | sperm principal piece | |
Molecular Function | calcium-activated cation channel activity | |
Molecular Function | voltage-gated calcium channel activity | |
Biological Process | calcium ion transport | |
Biological Process | cell differentiation | |
Biological Process | flagellated sperm motility | |
Biological Process | fusion of sperm to egg plasma membrane involved in single fertilization | |
Biological Process | regulation of calcium ion transport | |
Biological Process | regulation of cilium beat frequency involved in ciliary motility | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCation channel sperm-associated protein 1
- Short namesCatSper1
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ91ZR5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell projection, cilium, flagellum membrane ; Multi-pass membrane protein
Note: Specifically located in the principal piece of the sperm tail.
Features
Showing features for topological domain, transmembrane, intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-351 | Cytoplasmic | ||||
Sequence: MDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPYQQHGGFHQQNELQHLREFSDSHDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGGPQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADTISYRSSTRFYRSHAPFSRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHIHHRSPSASQLSHKSHSTLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASLSEGEDHVQKRKKAQRAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSL | ||||||
Transmembrane | 352-373 | Helical; Name=Segment S1 | ||||
Sequence: GFETFIFIVVCLNTVILVAQTF | ||||||
Topological domain | 374-382 | Extracellular | ||||
Sequence: TELEIRGEW | ||||||
Transmembrane | 383-404 | Helical; Name=Segment S2 | ||||
Sequence: YFMVLDSIFLSIYVLEAVLKLI | ||||||
Topological domain | 405-412 | Cytoplasmic | ||||
Sequence: ALGLEYFY | ||||||
Transmembrane | 413-435 | Helical; Name=Segment S3 | ||||
Sequence: DPWNNLDFFIMVMAVLDFVLLQI | ||||||
Topological domain | 436-446 | Extracellular | ||||
Sequence: NSLSYSFYNHS | ||||||
Transmembrane | 447-469 | Helical; Name=Segment S4 | ||||
Sequence: LFRILKVFKSMRALRAIRVLRRL | ||||||
Topological domain | 470-487 | Cytoplasmic | ||||
Sequence: SILTSLHEVAGTLSGSLP | ||||||
Transmembrane | 488-510 | Helical; Name=Segment S5 | ||||
Sequence: SITAILTLMFTCLFLFSVVLRAL | ||||||
Topological domain | 511-521 | Extracellular | ||||
Sequence: FQDSDPKRFQN | ||||||
Intramembrane | 522-534 | Helical; Pore-forming | ||||
Sequence: IFTTLFTLFTMLT | ||||||
Topological domain | 535-551 | Extracellular | ||||
Sequence: LDDWSLIYIDNRAQGAW | ||||||
Transmembrane | 552-577 | Helical; Name=Segment S6 | ||||
Sequence: YIIPILMIYIVIQYFIFLNLVIAVLV | ||||||
Topological domain | 578-686 | Cytoplasmic | ||||
Sequence: DNFQMALLKGLEKVKLEQAARVHEKLLDDSLTDLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQKFRSQAYVIDELVDMAFEAGDDDYGK |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mice are normal but males are sterile. Male sterility is due to defects in sperm motility unability to fertilize intact eggs (PubMed:11595941).
Sperm of the CatSper1 null mutant lack CatSper2 protein, while sperm of the CatSper2 null mutant, lack CatSper1 protein, suggesting that stable expression of CatSper1 protein requires CatSper2 and vice versa (PubMed:16036917).
Sperm of the CatSper1 null mutant lack CatSper2 protein, while sperm of the CatSper2 null mutant, lack CatSper1 protein, suggesting that stable expression of CatSper1 protein requires CatSper2 and vice versa (PubMed:16036917).
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 25 | in strain: 72 | ||||
Sequence: S → SHP | ||||||
Natural variant | 52 | in strain: 2, 47 and 58 | ||||
Sequence: M → R | ||||||
Natural variant | 160 | in strain: 47 | ||||
Sequence: Missing | ||||||
Natural variant | 270 | in strain: 72 | ||||
Sequence: T → I | ||||||
Natural variant | 276 | in strain: 72 | ||||
Sequence: Y → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 43 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000295675 | 1-686 | Cation channel sperm-associated protein 1 | |||
Sequence: MDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPYQQHGGFHQQNELQHLREFSDSHDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGGPQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADTISYRSSTRFYRSHAPFSRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHIHHRSPSASQLSHKSHSTLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASLSEGEDHVQKRKKAQRAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSLGFETFIFIVVCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDFFIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAGTLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSLIYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLEQAARVHEKLLDDSLTDLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQKFRSQAYVIDELVDMAFEAGDDDYGK |
Proteomic databases
PTM databases
Expression
Tissue specificity
Testis-specific.
Developmental stage
Detected only after round spermatids are produced approximately at day 18.
Gene expression databases
Interaction
Subunit
Component of the CatSper complex or CatSpermasome composed of the core pore-forming members CATSPER1, CATSPER2, CATSPER3 and CATSPER4 as well as auxiliary members CATSPERB, CATSPERG2, CATSPERD, CATSPERE, CATSPERZ, C2CD6/CATSPERT, SLCO6C1, TMEM249, TMEM262 and EFCAB9 (PubMed:17227845, PubMed:17478420, PubMed:19516020, PubMed:21224844, PubMed:34225353, PubMed:34998468).
HSPA1 may be an additional auxiliary complex member (PubMed:17478420, PubMed:19516020).
The core complex members CATSPER1, CATSPER2, CATSPER3 and CATSPER4 form a heterotetrameric channel (PubMed:34225353).
The auxiliary CATSPERB, CATSPERG2, CATSPERD and CATSPERE subunits form a pavilion-like structure over the pore which stabilizes the complex through interactions with CATSPER4, CATSPER3, CATSPER1 and CATSPER2 respectively (PubMed:34225353).
SLCO6C1 interacts with CATSPERE, and TMEM262/CATSPERH interacts with CATSPERB, further stabilizing the complex (PubMed:34225353).
C2CD6/CATSPERT interacts at least with CATSPERD and is required for targeting the CatSper complex in the flagellar membrane (PubMed:34998468).
Interacts with Ca(v)3.3/CACNA1I, leading to suppression of T-type calcium channel activity (By similarity).
HSPA1 may be an additional auxiliary complex member (PubMed:17478420, PubMed:19516020).
The core complex members CATSPER1, CATSPER2, CATSPER3 and CATSPER4 form a heterotetrameric channel (PubMed:34225353).
The auxiliary CATSPERB, CATSPERG2, CATSPERD and CATSPERE subunits form a pavilion-like structure over the pore which stabilizes the complex through interactions with CATSPER4, CATSPER3, CATSPER1 and CATSPER2 respectively (PubMed:34225353).
SLCO6C1 interacts with CATSPERE, and TMEM262/CATSPERH interacts with CATSPERB, further stabilizing the complex (PubMed:34225353).
C2CD6/CATSPERT interacts at least with CATSPERD and is required for targeting the CatSper complex in the flagellar membrane (PubMed:34998468).
Interacts with Ca(v)3.3/CACNA1I, leading to suppression of T-type calcium channel activity (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q91ZR5 | Catsper3 Q80W99 | 2 | EBI-15619083, EBI-15619135 | |
BINARY | Q91ZR5 | Catsper4 Q8BVN3 | 2 | EBI-15619083, EBI-15619199 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Basic and acidic residues | ||||
Sequence: MDQSSRRDESYHETHP | ||||||
Region | 1-57 | Disordered | ||||
Sequence: MDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPY | ||||||
Region | 97-177 | Disordered | ||||
Sequence: TLPNNISHAYGGSHPLAESQHSGGPQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDH | ||||||
Compositional bias | 129-143 | Basic and acidic residues | ||||
Sequence: PNHHPHQDDPHRPSE | ||||||
Compositional bias | 144-159 | Polar residues | ||||
Sequence: PLSHPSSTGSHQGTTH | ||||||
Compositional bias | 160-174 | Basic and acidic residues | ||||
Sequence: QQYHERSHHLNPQQN | ||||||
Region | 207-271 | Disordered | ||||
Sequence: DHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHIHHRSPSASQLSHKSHSTLATSPSHVGSKSTA | ||||||
Compositional bias | 208-248 | Basic residues | ||||
Sequence: HHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHIHHRSPSAS | ||||||
Compositional bias | 249-271 | Polar residues | ||||
Sequence: QLSHKSHSTLATSPSHVGSKSTA | ||||||
Region | 289-318 | Disordered | ||||
Sequence: QSRESLRESASLSEGEDHVQKRKKAQRAHK |
Sequence similarities
Belongs to the cation channel sperm-associated (TC 1.A.1.19) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length686
- Mass (Da)78,706
- Last updated2001-12-01 v1
- Checksum2E85FFE72B3147BC
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A494B9U9 | A0A494B9U9_MOUSE | Catsper1 | 496 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Basic and acidic residues | ||||
Sequence: MDQSSRRDESYHETHP | ||||||
Compositional bias | 129-143 | Basic and acidic residues | ||||
Sequence: PNHHPHQDDPHRPSE | ||||||
Compositional bias | 144-159 | Polar residues | ||||
Sequence: PLSHPSSTGSHQGTTH | ||||||
Compositional bias | 160-174 | Basic and acidic residues | ||||
Sequence: QQYHERSHHLNPQQN | ||||||
Compositional bias | 208-248 | Basic residues | ||||
Sequence: HHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHIHHRSPSAS | ||||||
Compositional bias | 249-271 | Polar residues | ||||
Sequence: QLSHKSHSTLATSPSHVGSKSTA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF407332 EMBL· GenBank· DDBJ | AAL14104.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ021482 EMBL· GenBank· DDBJ | AAY63820.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021483 EMBL· GenBank· DDBJ | AAY63821.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021484 EMBL· GenBank· DDBJ | AAY63822.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021485 EMBL· GenBank· DDBJ | AAY63823.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021486 EMBL· GenBank· DDBJ | AAY63824.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021488 EMBL· GenBank· DDBJ | AAY63826.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021489 EMBL· GenBank· DDBJ | AAY63827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021490 EMBL· GenBank· DDBJ | AAY63828.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021491 EMBL· GenBank· DDBJ | AAY63829.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ021492 EMBL· GenBank· DDBJ | AAY63830.1 EMBL· GenBank· DDBJ | Genomic DNA |