Q91ZA8 · NRARP_MOUSE
- ProteinNotch-regulated ankyrin repeat-containing protein
- GeneNrarp
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids114 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Downstream effector of Notch signaling. Involved in the regulation of liver cancer cells self-renewal (By similarity).
Involved in the regulation of canonical Wnt signaling by stabilizing LEF1 (By similarity).
Involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. Proposed to integrate endothelial Notch and Wnt signaling to control stalk cell proliferation and to stablilize new endothelial connections during angiogenesis (PubMed:19154719).
During somitogenesis involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae. Required for proper anterior-posterior somite patterning. Proposed to function in a negative feedback loop to destabilize Notch 1 intracellular domain (NICD) and down-regulate the Notch signal, preventing expansion of the Notch signal into the anterior somite domain (PubMed:21795391, PubMed:21998026).
Involved in the regulation of canonical Wnt signaling by stabilizing LEF1 (By similarity).
Involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. Proposed to integrate endothelial Notch and Wnt signaling to control stalk cell proliferation and to stablilize new endothelial connections during angiogenesis (PubMed:19154719).
During somitogenesis involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae. Required for proper anterior-posterior somite patterning. Proposed to function in a negative feedback loop to destabilize Notch 1 intracellular domain (NICD) and down-regulate the Notch signal, preventing expansion of the Notch signal into the anterior somite domain (PubMed:21795391, PubMed:21998026).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Biological Process | blood vessel endothelial cell proliferation involved in sprouting angiogenesis | |
Biological Process | branching involved in blood vessel morphogenesis | |
Biological Process | endothelial cell proliferation | |
Biological Process | negative regulation of Notch signaling pathway | |
Biological Process | negative regulation of T cell differentiation | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | Notch signaling pathway | |
Biological Process | positive regulation of canonical Wnt signaling pathway | |
Biological Process | positive regulation of endothelial cell proliferation | |
Biological Process | positive regulation of vascular endothelial cell proliferation | |
Biological Process | regulation of cell-cell adhesion | |
Biological Process | somite rostral/caudal axis specification | |
Biological Process | sprouting angiogenesis | |
Biological Process | T cell differentiation | |
Biological Process | vascular endothelial cell proliferation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameNotch-regulated ankyrin repeat-containing protein
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ91ZA8
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Axial skeletal defects in newborn mice such as rib fusions, fused vertebral bodies and fused pedicles of the vertebrae; defects are influenced by the strain-specific genetic background. Embryos exhibit expansion and fusion of myotomes, dorsal root ganglia fusions and defects in projection of the spinal nerves. Embryos show increased level of Notch 1 intracellular domain (NICD) expression in presomitic mesoderm and somites (PubMed:21998026).
In contrast, fewer somites and vertebrae found in -/- are linked to a longer segmentation clock period (PubMed:21795391).
Defects in the radial expansion of the vascular plexus from the optic nerve head to the periphery, reduction of retinal vessel density; however, most of the defects in angiogenesis resolve over time (PubMed:19154719).
In contrast, fewer somites and vertebrae found in -/- are linked to a longer segmentation clock period (PubMed:21795391).
Defects in the radial expansion of the vascular plexus from the optic nerve head to the periphery, reduction of retinal vessel density; however, most of the defects in angiogenesis resolve over time (PubMed:19154719).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000325080 | 1-114 | Notch-regulated ankyrin repeat-containing protein | |||
Sequence: MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at high levels in the brain, heart, colon, kidney, liver, lung and small intestine. Expressed in retina, most prominent in endothelial cells at the migrating point of the vasculature behind leading tip cells. Expressed in testis.
Induction
By Notch signaling via a CBF1/Su(H)/Lag-1 (CSL)-dependent pathway.
Developmental stage
During embryogenesis, expressed in several tissues in which cellular differentiation is regulated by the notch signaling pathway. At 10.5 dpc expressed in intersomatic vessels and in vessels of the limb buds with strongest expression at vascular branch points. Cyclic expression between 8.5 dpc and 10.5 dpc somitogenesis is dependent on DLL3.
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 50-79 | ANK 1 | ||||
Sequence: EGQTALHQSVIDGNLELVKLLVKFGADIRL | ||||||
Repeat | 83-112 | ANK 2 | ||||
Sequence: DGWSALHIAAFGGHQDIVLYLITKAKYAAS |
Sequence similarities
Belongs to the NRARP family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q91ZA8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length114
- Mass (Da)12,492
- Last updated2001-12-01 v1
- ChecksumC8B84B648DB47F4F
Q91ZA8-2
- Name2
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY046077 EMBL· GenBank· DDBJ | AAL05944.1 EMBL· GenBank· DDBJ | mRNA | ||
AK012426 EMBL· GenBank· DDBJ | BAB28231.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AL732309 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC048088 EMBL· GenBank· DDBJ | AAH48088.1 EMBL· GenBank· DDBJ | mRNA | ||
BC069891 EMBL· GenBank· DDBJ | AAH69891.1 EMBL· GenBank· DDBJ | mRNA |