Q91Z31 · PTBP2_MOUSE
- ProteinPolypyrimidine tract-binding protein 2
- GenePtbp2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids531 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing (PubMed:10829067, PubMed:30638744).
May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection (PubMed:10829067).
In addition to its function in pre-mRNA splicing, also plays a role in the regulation of translation (PubMed:11726525).
May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection (PubMed:10829067).
In addition to its function in pre-mRNA splicing, also plays a role in the regulation of translation (PubMed:11726525).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | growth cone | |
Cellular Component | neuronal cell body | |
Cellular Component | nucleus | |
Cellular Component | spliceosomal complex | |
Molecular Function | mRNA binding | |
Biological Process | mRNA splice site recognition | |
Biological Process | negative regulation of RNA splicing | |
Biological Process | regulation of neural precursor cell proliferation | |
Biological Process | regulation of RNA splicing |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended namePolypyrimidine tract-binding protein 2
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ91Z31
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000232929 | 1-531 | Polypyrimidine tract-binding protein 2 | |||
Sequence: MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI | ||||||
Modified residue | 26 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 27 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 308 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Mainly expressed in brain, including cerebellum, brainstem, spinal cord, and hypothalamus. Also expressed in the peripheral nervous system and neural crest derivatives, including the dorsal root and trigeminal ganglia, the cochlear spiral and intestinal ganglion cells, and the adrenal medulla. Also detected to a lower extent in testis, heart, liver, lung, skeletal muscle and thymus (at protein level).
Developmental stage
Expressed in whole brain tissues from 11.5 dpc to adulthood.
Gene expression databases
Interaction
Subunit
Monomer. Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1. Part of a ternary complex containing KHSRP and HNRPH1 (By similarity).
Interacts with NOVA1; the interaction is direct (PubMed:10829067).
Interacts with NOVA2; the interaction is direct (PubMed:10829067).
Interacts with NOVA1; the interaction is direct (PubMed:10829067).
Interacts with NOVA2; the interaction is direct (PubMed:10829067).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q91Z31 | Aicda Q9WVE0 | 4 | EBI-647632, EBI-3835567 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 59-133 | RRM 1 | ||||
Sequence: RVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNH | ||||||
Domain | 181-257 | RRM 2 | ||||
Sequence: LRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKL | ||||||
Domain | 338-412 | RRM 3 | ||||
Sequence: TVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKH | ||||||
Domain | 455-529 | RRM 4 | ||||
Sequence: ATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q91Z31-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length531
- Mass (Da)57,489
- Last updated2006-04-18 v2
- Checksum3A93CA4E3E1D6AA3
Q91Z31-2
- Name2
- Differences from canonical
- 489-489: Q → QR
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q3V328 | Q3V328_MOUSE | Ptbp2 | 241 | ||
A0A0G2JFV8 | A0A0G2JFV8_MOUSE | Ptbp2 | 155 | ||
A0A0G2JGW0 | A0A0G2JGW0_MOUSE | Ptbp2 | 356 | ||
A0A0G2JE77 | A0A0G2JE77_MOUSE | Ptbp2 | 49 | ||
A0A0G2JEB9 | A0A0G2JEB9_MOUSE | Ptbp2 | 33 |
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 93 | in Ref. 3; AAH10255 | ||||
Sequence: G → E | ||||||
Alternative sequence | VSP_018019 | 489 | in isoform 2 | |||
Sequence: Q → QR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF095718 EMBL· GenBank· DDBJ | AAF21807.2 EMBL· GenBank· DDBJ | mRNA | ||
AK013734 EMBL· GenBank· DDBJ | BAB28977.1 EMBL· GenBank· DDBJ | mRNA | ||
AK137348 EMBL· GenBank· DDBJ | BAE23317.1 EMBL· GenBank· DDBJ | mRNA | ||
BC010255 EMBL· GenBank· DDBJ | AAH10255.1 EMBL· GenBank· DDBJ | mRNA | ||
AY333752 EMBL· GenBank· DDBJ | AAQ01150.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK000527 EMBL· GenBank· DDBJ | DAA00061.1 EMBL· GenBank· DDBJ | mRNA |