Q91YM4 · FAKD4_MOUSE
- ProteinFAST kinase domain-containing protein 4
- GeneTbrg4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids630 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Plays a role in processing of mitochondrial RNA precursors and in stabilization of a subset of mature mitochondrial RNA species, such as MT-CO1, MT-CO2, MT-CYB, MT-CO3, MT-ND3, MT-ND5 and MT-ATP8/6. May play a role in cell cycle progression.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Cellular Component | ribonucleoprotein granule | |
Molecular Function | RNA binding | |
Biological Process | mitochondrial mRNA processing | |
Biological Process | mitochondrial RNA processing | |
Biological Process | mRNA metabolic process | |
Biological Process | regulation of mitochondrial mRNA stability |
Names & Taxonomy
Protein names
- Recommended nameFAST kinase domain-containing protein 4
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ91YM4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, transit peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000273027 | ?-630 | FAST kinase domain-containing protein 4 | |||
Sequence: MAVRLMKRCTCLLREATRLVPTVAPVGRLRLAGVSCKTLTSSVSSPSSGSLAELLGKEQVFTPYPEHQELDFLIEKASRPEQLLELLGSDHSLHHNHAALILIRLSYLLSEKPKEKALLAEDARFQRLVKLVDSQITCVWHGTLVKLLRSLYTLVLPQISKELQSVEQEVRWRLRRLKYKHLVFLAESCASFMKEQHSQELLAELLMHLERRWTEINDSRTLVTMMTMAGHLSESLMNHLEDKCLELVEQFGPDELRKVLVTLAAQSRRSVPLLRAISYHLVQKPFPMTKGMLLDLAYAYGKLSFHQTQVSQRLAADLLPFIPSMTPGEVARCAKSFAFLKWLNLPLFEAFTQHLLSRVQDVSLSHVCSVLLAFARLNFHPEQEEDQFFSMVHEKLDPVLGSLEPALQVDLVWALCVLQHVHETELHTVLHPGLHARFLESKSPKDQSTFQKLVHINTTALLEHPEYKGPFLPASAVAPIPSPSNKKMTPLQKELQETLKALLGNTDKGSLEVATQYGWVLDAEVLLDADGHFLPLRNFVAPHLAQPVGNQPLPPGAKRIAFLRWEFPNFNSRSKDLLGRFVLARRHVLAAGFLVVDVPYYEWLDLKSEWQKSAYLKDKMRKAMAEELAK | ||||||
Transit peptide | 1-? | Mitochondrion |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expression detected in spleen, testis, colon, heart, smooth muscle, kidney, brain, lung, liver, brown and white adipose tissue with highest expression in testis, heart, smooth muscle and brown adipose tissue.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 560-618 | RAP | ||||
Sequence: IAFLRWEFPNFNSRSKDLLGRFVLARRHVLAAGFLVVDVPYYEWLDLKSEWQKSAYLKD |
Sequence similarities
Belongs to the FAST kinase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q91YM4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length630
- Mass (Da)71,513
- Last updated2001-12-01 v1
- Checksum22BD82426988C195
Q91YM4-2
- Name2
- Differences from canonical
- 77-107: ASRPEQLLELLGSDHSLHHNHAALILIRLSY → D
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_022461 | 77-107 | in isoform 2 | |||
Sequence: ASRPEQLLELLGSDHSLHHNHAALILIRLSY → D | ||||||
Sequence conflict | 166 | in Ref. 2; BAC36037 | ||||
Sequence: V → L | ||||||
Sequence conflict | 224 | in Ref. 2; BAC36037 | ||||
Sequence: T → I | ||||||
Sequence conflict | 286 | in Ref. 5; AAC36538 | ||||
Sequence: F → S | ||||||
Sequence conflict | 316 | in Ref. 5; AAC36538 | ||||
Sequence: A → V | ||||||
Sequence conflict | 327 | in Ref. 5; AAC36538 | ||||
Sequence: P → S |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK129245 EMBL· GenBank· DDBJ | BAC98055.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK075897 EMBL· GenBank· DDBJ | BAC36037.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK166760 EMBL· GenBank· DDBJ | BAE38999.1 EMBL· GenBank· DDBJ | mRNA | ||
AK168088 EMBL· GenBank· DDBJ | BAE40061.1 EMBL· GenBank· DDBJ | mRNA | ||
AL603787 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC016483 EMBL· GenBank· DDBJ | AAH16483.1 EMBL· GenBank· DDBJ | mRNA | ||
BC031155 EMBL· GenBank· DDBJ | AAH31155.1 EMBL· GenBank· DDBJ | mRNA | ||
BC031910 EMBL· GenBank· DDBJ | AAH31910.1 EMBL· GenBank· DDBJ | mRNA | ||
U89434 EMBL· GenBank· DDBJ | AAC36538.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |