Q91WA1 · TIPIN_MOUSE
- ProteinTIMELESS-interacting protein
- GeneTipin
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids278 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays an important role in the control of DNA replication and the maintenance of replication fork stability. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | replication fork protection complex | |
Molecular Function | DNA binding | |
Biological Process | cell cycle phase transition | |
Biological Process | cell division | |
Biological Process | DNA damage checkpoint signaling | |
Biological Process | DNA replication checkpoint signaling | |
Biological Process | mitotic intra-S DNA damage checkpoint signaling | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | replication fork arrest | |
Biological Process | replication fork processing | |
Biological Process | response to UV |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTIMELESS-interacting protein
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ91WA1
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000305254 | 1-278 | TIMELESS-interacting protein | |||
Sequence: MLEQEENGLFEIPDYEHVEDETFPPFPPPASPERDPADAEPEEGSGSGVPVPPKRTVKRNLPKLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLGNKKEVQTCLKRIRLDLPIVHEDFVNNNDEVGEANGPDVSATGFDPFLTSSSDSRKFASEPTRSLTEEQQQRIERNKQLALERRQAKLLSNSQSLENDVTVEENSTGEDQEESNGLNIDTADGPHDVPFASTHEEEQCKAEETQLDHTNLD | ||||||
Modified residue | 191 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 219 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 233 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain.
Developmental stage
Expression peaks between 11 dpc and 15 dpc. At 7.5 dpc, expressed in germ cell layers. At 14.5 dpc, expressed at highest levels in thymus, liver, gastrointestinal tract, lung and the rapidly proliferating ventricular zone of the brain.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-59 | Disordered | ||||
Sequence: MLEQEENGLFEIPDYEHVEDETFPPFPPPASPERDPADAEPEEGSGSGVPVPPKRTVKR | ||||||
Region | 64-140 | Interaction with TIMELESS | ||||
Sequence: LDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLGNKKEVQTCLKRI | ||||||
Region | 155-197 | Disordered | ||||
Sequence: NDEVGEANGPDVSATGFDPFLTSSSDSRKFASEPTRSLTEEQQ | ||||||
Compositional bias | 171-193 | Polar residues | ||||
Sequence: FDPFLTSSSDSRKFASEPTRSLT | ||||||
Region | 216-278 | Disordered | ||||
Sequence: LSNSQSLENDVTVEENSTGEDQEESNGLNIDTADGPHDVPFASTHEEEQCKAEETQLDHTNLD | ||||||
Compositional bias | 255-278 | Basic and acidic residues | ||||
Sequence: PFASTHEEEQCKAEETQLDHTNLD |
Sequence similarities
Belongs to the CSM3 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length278
- Mass (Da)31,498
- Last updated2007-10-02 v2
- Checksum769F56BBDF2763C9
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1L1SUT4 | A0A1L1SUT4_MOUSE | Tipin | 93 | ||
A0A1L1STK1 | A0A1L1STK1_MOUSE | Tipin | 93 | ||
A0A1L1SUJ5 | A0A1L1SUJ5_MOUSE | Tipin | 111 |
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 67 | in Ref. 1; BAB22798 | ||||
Sequence: T → A | ||||||
Compositional bias | 171-193 | Polar residues | ||||
Sequence: FDPFLTSSSDSRKFASEPTRSLT | ||||||
Compositional bias | 255-278 | Basic and acidic residues | ||||
Sequence: PFASTHEEEQCKAEETQLDHTNLD | ||||||
Sequence conflict | 265 | in Ref. 2; AAH16211 | ||||
Sequence: C → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK003451 EMBL· GenBank· DDBJ | BAB22798.1 EMBL· GenBank· DDBJ | mRNA | ||
AK003802 EMBL· GenBank· DDBJ | BAB23004.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011357 EMBL· GenBank· DDBJ | BAB27565.1 EMBL· GenBank· DDBJ | mRNA | ||
AK038111 EMBL· GenBank· DDBJ | BAC29931.1 EMBL· GenBank· DDBJ | mRNA | ||
BC016211 EMBL· GenBank· DDBJ | AAH16211.1 EMBL· GenBank· DDBJ | mRNA | ||
BK001385 EMBL· GenBank· DDBJ | DAA01364.1 EMBL· GenBank· DDBJ | mRNA |