Q91VB8 · Q91VB8_MOUSE
- ProteinAlpha globin 1
- GeneHba-a1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids142 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Involved in oxygen transport from the lung to the various peripheral tissues.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | hemoglobin complex | |
Molecular Function | heme binding | |
Molecular Function | iron ion binding | |
Molecular Function | oxygen binding | |
Molecular Function | oxygen carrier activity | |
Biological Process | erythrocyte development | |
Biological Process | in utero embryonic development | |
Biological Process | response to bacterium |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ91VB8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-142 | Globin | ||||
Sequence: LSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR |
Sequence similarities
Belongs to the globin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length142
- Mass (Da)15,112
- Last updated2001-12-01 v1
- Checksum2F6A3712E555CB4A
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P01942 | HBA_MOUSE | Hba | 142 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC043020 EMBL· GenBank· DDBJ | AAH43020.1 EMBL· GenBank· DDBJ | mRNA | ||
AY016021 EMBL· GenBank· DDBJ | AAL32371.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY016021 EMBL· GenBank· DDBJ | AAL32372.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
EF605472 EMBL· GenBank· DDBJ | ABU54054.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK003077 EMBL· GenBank· DDBJ | BAB22552.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005434 EMBL· GenBank· DDBJ | BAB24028.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010923 EMBL· GenBank· DDBJ | BAB27269.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010927 EMBL· GenBank· DDBJ | BAB27272.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010933 EMBL· GenBank· DDBJ | BAB27277.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010937 EMBL· GenBank· DDBJ | BAB27279.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010987 EMBL· GenBank· DDBJ | BAB27307.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011018 EMBL· GenBank· DDBJ | BAB27336.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011023 EMBL· GenBank· DDBJ | BAB27340.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011025 EMBL· GenBank· DDBJ | BAB27342.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011028 EMBL· GenBank· DDBJ | BAB27344.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011030 EMBL· GenBank· DDBJ | BAB27346.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011055 EMBL· GenBank· DDBJ | BAB27364.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011073 EMBL· GenBank· DDBJ | BAB27378.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011121 EMBL· GenBank· DDBJ | BAB27414.1 EMBL· GenBank· DDBJ | mRNA | ||
AK012329 EMBL· GenBank· DDBJ | BAB28166.1 EMBL· GenBank· DDBJ | mRNA | ||
AK012348 EMBL· GenBank· DDBJ | BAB28179.1 EMBL· GenBank· DDBJ | mRNA | ||
AK012755 EMBL· GenBank· DDBJ | BAB28446.1 EMBL· GenBank· DDBJ | mRNA | ||
AK019138 EMBL· GenBank· DDBJ | BAB31564.1 EMBL· GenBank· DDBJ | mRNA | ||
AK028173 EMBL· GenBank· DDBJ | BAC25790.1 EMBL· GenBank· DDBJ | mRNA | ||
AK171893 EMBL· GenBank· DDBJ | BAE42724.1 EMBL· GenBank· DDBJ | mRNA | ||
LT548154 EMBL· GenBank· DDBJ | SAI82198.1 EMBL· GenBank· DDBJ | Genomic DNA |