Q91636 · KIF2C_XENLA
- ProteinKinesin-like protein KIF2C
- Genekif2c
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids730 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Promotes ATP-dependent removal of tubulin dimers from microtubules. Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis (PubMed:8548824).
May play a role in chromosome congression and may be required for the lateral to end-on conversion of the chromosome-microtubule attachment (By similarity).
May play a role in chromosome congression and may be required for the lateral to end-on conversion of the chromosome-microtubule attachment (By similarity).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | kinetochore | |
Cellular Component | microtubule plus-end | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | microtubule binding | |
Molecular Function | microtubule motor activity | |
Biological Process | attachment of mitotic spindle microtubules to kinetochore | |
Biological Process | cell division | |
Biological Process | metaphase chromosome alignment | |
Biological Process | microtubule-based movement |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameKinesin-like protein KIF2C
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionQ91636
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000125422 | 1-730 | Kinesin-like protein KIF2C | |||
Sequence: MERLVATRLVTGLAVKIMRSNGVIHNANITSVNMDRSSVNVEWKEGEANKGKEISFADVISVNPELLDAVLAPTNVKENMPPQRNVSSQNHKRKTISKIPAPKEVAAKNSLLSESGAQSVLRERSTRMTAIHETLPYENEMEAESTPLPIQQNSVQARSRSTKVSIAEEPRLQTRISEIVEESLPSGRNNQGRRKSNIVKEMEKMKNKREEQRAQNYERRMKRAQDYDTSVPNWEFGKMIKEFRATMDCHRISMADPAEEHRICVCVRKRPLNKQELSKKEIDIISVPSKNIVLVHEPKLKVDLTKYLENQAFRFDFSFDETATNEVVYRFTARPLVQSIFEGGKATCFAYGQTGSGKTHTMGGDFSGKSQNVSKGVYAFASRDVFLLLDQPRYKHLDLDVFVTFFEIYNGKVFDLLNKKTKLRVLEDAKQEVQVVGLLEKQVISADDVFKMIEIGSACRTSGQTFANTSSSRSHACLQIILRRGSKLHGKFSLVDLAGNERGVDTASADRITRMEGAEINRSLLALKECIRALGQNKSHTPFRESKLTQILRDSFIGENSRTCMIAMLSPGFNSCEYTLNTLRYADRVKELSPQNAETNDDNLQMEDSGGSHASIEGLQLQDDFLLKDEELSTHNSFQDALNRVGELEDKAVDELRELVQKEPEWTNLLQMTEQPDYDLENFVMQAEYLIQERSKVLIALGDSINSLRLALQVEEQASKQISKKKRSNK |
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-256 | Globular | ||||
Sequence: MERLVATRLVTGLAVKIMRSNGVIHNANITSVNMDRSSVNVEWKEGEANKGKEISFADVISVNPELLDAVLAPTNVKENMPPQRNVSSQNHKRKTISKIPAPKEVAAKNSLLSESGAQSVLRERSTRMTAIHETLPYENEMEAESTPLPIQQNSVQARSRSTKVSIAEEPRLQTRISEIVEESLPSGRNNQGRRKSNIVKEMEKMKNKREEQRAQNYERRMKRAQDYDTSVPNWEFGKMIKEFRATMDCHRISMAD | ||||||
Compositional bias | 79-95 | Polar residues | ||||
Sequence: NMPPQRNVSSQNHKRKT | ||||||
Region | 79-98 | Disordered | ||||
Sequence: NMPPQRNVSSQNHKRKTISK | ||||||
Region | 211-242 | Negative regulator of microtubule-binding | ||||
Sequence: EQRAQNYERRMKRAQDYDTSVPNWEFGKMIKE | ||||||
Domain | 262-592 | Kinesin motor | ||||
Sequence: RICVCVRKRPLNKQELSKKEIDIISVPSKNIVLVHEPKLKVDLTKYLENQAFRFDFSFDETATNEVVYRFTARPLVQSIFEGGKATCFAYGQTGSGKTHTMGGDFSGKSQNVSKGVYAFASRDVFLLLDQPRYKHLDLDVFVTFFEIYNGKVFDLLNKKTKLRVLEDAKQEVQVVGLLEKQVISADDVFKMIEIGSACRTSGQTFANTSSSRSHACLQIILRRGSKLHGKFSLVDLAGNERGVDTASADRITRMEGAEINRSLLALKECIRALGQNKSHTPFRESKLTQILRDSFIGENSRTCMIAMLSPGFNSCEYTLNTLRYADRVKEL | ||||||
Coiled coil | 599-730 | |||||
Sequence: TNDDNLQMEDSGGSHASIEGLQLQDDFLLKDEELSTHNSFQDALNRVGELEDKAVDELRELVQKEPEWTNLLQMTEQPDYDLENFVMQAEYLIQERSKVLIALGDSINSLRLALQVEEQASKQISKKKRSNK |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length730
- Mass (Da)82,586
- Last updated2001-05-04 v2
- Checksum25C31C187E491523
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 79-95 | Polar residues | ||||
Sequence: NMPPQRNVSSQNHKRKT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U36485 EMBL· GenBank· DDBJ | AAC59743.2 EMBL· GenBank· DDBJ | mRNA | ||
BC044976 EMBL· GenBank· DDBJ | AAH44976.1 EMBL· GenBank· DDBJ | mRNA |