Q8WZM0 · GCN5_YARLI
- ProteinHistone acetyltransferase GCN5
- GeneGCN5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids464 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Acetylates histone H2B to form H2BK11ac and H2BK16ac, histone H3 to form H3K14ac, with a lower preference histone H4 to form H4K8ac and H4K16ac, and contributes to H2A.Z acetylation. Acetylation of histones gives a specific tag for epigenetic transcription activation (By similarity).
Catalytic activity
- acetyl-CoA + L-lysyl-[protein] = CoA + H+ + N6-acetyl-L-lysyl-[protein]
Features
Showing features for active site, site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 200 | Proton donor/acceptor | ||||
Sequence: E | ||||||
Site | 200 | Important for catalytic activity | ||||
Sequence: E | ||||||
Binding site | 204-206 | acetyl-CoA (UniProtKB | ChEBI) | ||||
Sequence: CAI | ||||||
Binding site | 211-217 | acetyl-CoA (UniProtKB | ChEBI) | ||||
Sequence: QVRGYGA | ||||||
Binding site | 243-246 | acetyl-CoA (UniProtKB | ChEBI) | ||||
Sequence: YAIG |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | histone acetyltransferase complex | |
Cellular Component | nucleus | |
Cellular Component | SAGA complex | |
Molecular Function | histone H3 acetyltransferase activity | |
Molecular Function | histone H3K14 acetyltransferase activity | |
Molecular Function | histone H3K18 acetyltransferase activity | |
Molecular Function | histone H3K9 acetyltransferase activity | |
Biological Process | chromatin remodeling | |
Biological Process | negative regulation of induction of conjugation with cellular fusion | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | transcription initiation-coupled chromatin remodeling |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHistone acetyltransferase GCN5
- EC number
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Dipodascaceae > Yarrowia
Accessions
- Primary accessionQ8WZM0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000211200 | 1-464 | Histone acetyltransferase GCN5 | |||
Sequence: MDSDTESVKRRKSSGSESESSVRDPKRTKIEDEDFQENGIDDEDEEEEEEEAKDEGDEDDEEKGEDDEEDDEEKEGEDGEGEEEDEEEDEEKKREEEEKYVTSFNFDGVEYKYKERPAVIEEREGKIEFRVVNNDNSKENLMILTGLKNIFQKQLPKMPREYIARLVYDRSHVSMAVVRKPLTVVGGITFRPFDTRKFAEIVFCAISSTEQVRGYGAHLMNHLKDYVKATSPVMYFLTYADNYAIGYFKKQGFSKEISLDRSVWMGYIKDYEGGTLMQCSMLPRIRYLDVNKILLLQKALIHKKIRAISKSHVVRKGLDHFRDSTTPVDPMTIPGLKEAGWTPEMDELARRPKRGPHFAVMQHVLSELQNHASAWPFAQAVNRDEVPDYYEVIKEPMDLSTMEQRLEADSYKTMEEFVYDARLVFNNCRAYNNETTTYYKNANKLEKFMVAKIKEIPEYSHLVE |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-34 | Basic and acidic residues | ||||
Sequence: MDSDTESVKRRKSSGSESESSVRDPKRTKIEDED | ||||||
Region | 1-99 | Disordered | ||||
Sequence: MDSDTESVKRRKSSGSESESSVRDPKRTKIEDEDFQENGIDDEDEEEEEEEAKDEGDEDDEEKGEDDEEDDEEKEGEDGEGEEEDEEEDEEKKREEEEK | ||||||
Compositional bias | 35-93 | Acidic residues | ||||
Sequence: FQENGIDDEDEEEEEEEAKDEGDEDDEEKGEDDEEDDEEKEGEDGEGEEEDEEEDEEKK | ||||||
Domain | 127-282 | N-acetyltransferase | ||||
Sequence: IEFRVVNNDNSKENLMILTGLKNIFQKQLPKMPREYIARLVYDRSHVSMAVVRKPLTVVGGITFRPFDTRKFAEIVFCAISSTEQVRGYGAHLMNHLKDYVKATSPVMYFLTYADNYAIGYFKKQGFSKEISLDRSVWMGYIKDYEGGTLMQCSML | ||||||
Domain | 369-439 | Bromo | ||||
Sequence: QNHASAWPFAQAVNRDEVPDYYEVIKEPMDLSTMEQRLEADSYKTMEEFVYDARLVFNNCRAYNNETTTYY |
Sequence similarities
Belongs to the acetyltransferase family. GCN5 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length464
- Mass (Da)54,096
- Last updated2002-03-01 v1
- ChecksumA7F3FC0C3B6D2CC4
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-34 | Basic and acidic residues | ||||
Sequence: MDSDTESVKRRKSSGSESESSVRDPKRTKIEDED | ||||||
Compositional bias | 35-93 | Acidic residues | ||||
Sequence: FQENGIDDEDEEEEEEEAKDEGDEDDEEKGEDDEEDDEEKEGEDGEGEEEDEEEDEEKK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ237940 EMBL· GenBank· DDBJ | CAC80210.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CR382131 EMBL· GenBank· DDBJ | CAG79052.1 EMBL· GenBank· DDBJ | Genomic DNA |