Q8WXD2 · SCG3_HUMAN
- ProteinSecretogranin-3
- GeneSCG3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids468 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Member of the granin protein family that regulates the biogenesis of secretory granules (PubMed:19357184).
Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (By similarity).
May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway (PubMed:29154827).
Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (By similarity).
May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway (PubMed:29154827).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum lumen | |
Cellular Component | extracellular region | |
Cellular Component | secretory granule lumen | |
Cellular Component | secretory granule membrane | |
Cellular Component | transport vesicle membrane | |
Molecular Function | RNA binding | |
Biological Process | protein localization to secretory granule |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSecretogranin-3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8WXD2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, secretory vesicle membrane ; Peripheral membrane protein
Note: Associated with the secretory granule membrane through direct binding to cholesterol-enriched lipid rafts.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_013827 | 125 | in dbSNP:rs2305710 | |||
Sequence: S → N | ||||||
Natural variant | VAR_067273 | 167 | in dbSNP:rs17851186 | |||
Sequence: V → A | ||||||
Natural variant | VAR_034484 | 233 | in dbSNP:rs35664837 | |||
Sequence: M → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 502 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, modified residue, glycosylation, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Signal | 1-19 | UniProt | |||||
Sequence: MGFLGTGTWILVLVLPIQA | |||||||
Chain | PRO_0000005461 | 20-468 | UniProt | Secretogranin-3 | |||
Sequence: FPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL | |||||||
Modified residue | 37 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Glycosylation | 37 | UniProt | O-linked (Xyl...) (chondroitin sulfate) serine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 37 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Glycosylation | 216 | UniProt | O-linked (GalNAc...) threonine | ||||
Sequence: T | |||||||
Glycosylation | 231 | UniProt | O-linked (GalNAc...) threonine | ||||
Sequence: T | |||||||
Glycosylation | 359 | UniProt | O-linked (GalNAc...) serine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 359 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 362 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 362 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
O-glycosylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in urine (at protein level) (PubMed:25326458).
Expressed in brain, heart, kidney, liver and skeletal muscle
Expressed in brain, heart, kidney, liver and skeletal muscle
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with CHGA (By similarity) (PubMed:19357184).
Interacts with secretogranin II/SCG2 (PubMed:19357184).
Interacts (via C-terminus) with CPE (By similarity).
Interacts with secretogranin II/SCG2 (PubMed:19357184).
Interacts (via C-terminus) with CPE (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8WXD2 | SDCBP O00560 | 3 | EBI-12162999, EBI-727004 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 23-69 | Disordered | ||||
Sequence: PGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNY | ||||||
Compositional bias | 28-59 | Basic and acidic residues | ||||
Sequence: DKSLHNRELSAERPLNEQIAEAEEDKIKKTYP | ||||||
Region | 353-406 | Disordered | ||||
Sequence: KLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTE | ||||||
Compositional bias | 358-406 | Basic and acidic residues | ||||
Sequence: PSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTE |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q8WXD2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length468
- Mass (Da)53,005
- Last updated2004-04-13 v3
- Checksum5E6BBDDFFF3B8D82
Q8WXD2-2
- Name2
- Differences from canonical
- 1-232: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H0YKC2 | H0YKC2_HUMAN | SCG3 | 57 |
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_042876 | 1-232 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 28-59 | Basic and acidic residues | ||||
Sequence: DKSLHNRELSAERPLNEQIAEAEEDKIKKTYP | ||||||
Sequence conflict | 79 | in Ref. 1; AAD44483 | ||||
Sequence: K → R | ||||||
Sequence conflict | 150 | in Ref. 4; BAG52108 | ||||
Sequence: D → G | ||||||
Sequence conflict | 272-274 | in Ref. 1; AAD44483 | ||||
Sequence: EEL → RDF | ||||||
Compositional bias | 358-406 | Basic and acidic residues | ||||
Sequence: PSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTE | ||||||
Sequence conflict | 421 | in Ref. 4; BAG59111 | ||||
Sequence: K → R |
Polymorphism
Polymorphisms in the 5'-flanking region and in intron 1 may have an effect on transcriptional activity and be associated with an increase in subcutaneous, but not visceral, fat area. Hence, may influence the risk of obesity.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF078851 EMBL· GenBank· DDBJ | AAD44483.1 EMBL· GenBank· DDBJ | mRNA | ||
AF453583 EMBL· GenBank· DDBJ | AAL67431.1 EMBL· GenBank· DDBJ | mRNA | ||
AY359093 EMBL· GenBank· DDBJ | AAQ89451.1 EMBL· GenBank· DDBJ | mRNA | ||
AK075314 EMBL· GenBank· DDBJ | BAG52108.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290175 EMBL· GenBank· DDBJ | BAF82864.1 EMBL· GenBank· DDBJ | mRNA | ||
AK296466 EMBL· GenBank· DDBJ | BAG59111.1 EMBL· GenBank· DDBJ | mRNA | ||
AC020892 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471082 EMBL· GenBank· DDBJ | EAW77426.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC009511 EMBL· GenBank· DDBJ | AAH09511.2 EMBL· GenBank· DDBJ | mRNA | ||
BC014539 EMBL· GenBank· DDBJ | AAH14539.1 EMBL· GenBank· DDBJ | mRNA |