Q8WWH4 · ASZ1_HUMAN
- ProteinAnkyrin repeat, SAM and basic leucine zipper domain-containing protein 1
- GeneASZ1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids475 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in the regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | pi-body | |
Biological Process | cell differentiation | |
Biological Process | male meiotic nuclear division | |
Biological Process | regulatory ncRNA-mediated gene silencing | |
Biological Process | retrotransposon silencing | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAnkyrin repeat, SAM and basic leucine zipper domain-containing protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8WWH4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon activity during meiosis. Specifically localizes to pi-bodies, a subset of the nuage which contains primary piRNAs (By similarity).
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_024175 | 216 | in dbSNP:rs1029396 | |||
Sequence: K → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 579 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000066969 | 1-475 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | |||
Sequence: MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFLLKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLKDLIQKLQNERENDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK | ||||||
Modified residue | 17 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 18 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 20 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed exclusively in the testis and ovary and at higher levels in the adult testis compared with the adult ovary.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with DDX4, PIWIL1, RANBP9 and TDRD1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8WWH4 | BET1 O15155 | 3 | EBI-12239061, EBI-749204 | |
BINARY | Q8WWH4 | DEFB127 Q9H1M4 | 3 | EBI-12239061, EBI-10305240 | |
BINARY | Q8WWH4 | LPAR3 Q9UBY5 | 3 | EBI-12239061, EBI-12033434 | |
BINARY | Q8WWH4 | NRAC Q8N912 | 3 | EBI-12239061, EBI-12051377 | |
XENO | Q8WWH4 | rep PRO_0000449633 P0DTD1 | 4 | EBI-12239061, EBI-25492395 | |
BINARY | Q8WWH4 | SLC35A1 P78382 | 3 | EBI-12239061, EBI-12870360 | |
BINARY | Q8WWH4 | SMIM1 B2RUZ4 | 3 | EBI-12239061, EBI-12188413 | |
BINARY | Q8WWH4 | TMEM218 A2RU14 | 3 | EBI-12239061, EBI-10173151 | |
BINARY | Q8WWH4 | TMEM97 Q5BJF2 | 3 | EBI-12239061, EBI-12111910 | |
BINARY | Q8WWH4 | TNFRSF10C O14798 | 3 | EBI-12239061, EBI-717441 | |
BINARY | Q8WWH4 | TSPO2 Q5TGU0 | 3 | EBI-12239061, EBI-12195249 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, repeat, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-25 | Disordered | ||||
Sequence: MAASALRGLPVAGGGESSESEDDGW | ||||||
Repeat | 45-74 | ANK 1 | ||||
Sequence: EKKEKFKKAMTIGDVSLVQELLDSGISVDS | ||||||
Repeat | 78-107 | ANK 2 | ||||
Sequence: YGWTPLMYAASVANAELVRVLLDRGANASF | ||||||
Repeat | 110-144 | ANK 3 | ||||
Sequence: DKQSILITACSAHGSEEQILKCVELLLSRNADPNV | ||||||
Repeat | 148-177 | ANK 4 | ||||
Sequence: RLMTPIMYAARDGHTQVVALLVAHGAEVNT | ||||||
Repeat | 181-210 | ANK 5 | ||||
Sequence: NGYTALTWAARQGHKNIVLKLLELGANKML | ||||||
Repeat | 214-243 | ANK 6 | ||||
Sequence: DGKMPSEIAKRNKHHEIFNLLSFTLNPLEG | ||||||
Domain | 272-334 | SAM | ||||
Sequence: SYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q8WWH4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length475
- Mass (Da)53,458
- Last updated2002-03-01 v1
- Checksum71B317BC07080434
Q8WWH4-2
- Name2
- Differences from canonical
- 388-396: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_056918 | 388-396 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF461259 EMBL· GenBank· DDBJ | AAL68815.1 EMBL· GenBank· DDBJ | mRNA | ||
AK093445 EMBL· GenBank· DDBJ | BAC04167.1 EMBL· GenBank· DDBJ | mRNA | ||
CH236947 EMBL· GenBank· DDBJ | EAL24354.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC126186 EMBL· GenBank· DDBJ | AAI26187.1 EMBL· GenBank· DDBJ | mRNA | ||
BC126188 EMBL· GenBank· DDBJ | AAI26189.1 EMBL· GenBank· DDBJ | mRNA | ||
BC144212 EMBL· GenBank· DDBJ | AAI44213.1 EMBL· GenBank· DDBJ | mRNA |