Q8WVH0 · CPLX3_HUMAN
- ProteinComplexin-3
- GeneCPLX3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids158 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Complexin that regulates SNARE protein complex-mediated synaptic vesicle fusion (By similarity).
Required for the maintenance of synaptic ultrastructure in the adult retina (By similarity).
Positively regulates synaptic transmission through synaptic vesicle availability and exocytosis of neurotransmitters at photoreceptor ribbon synapses in the retina (By similarity).
Suppresses tonic photoreceptor activity and baseline 'noise' by suppression of Ca2+ vesicle tonic release and the facilitation of evoked synchronous and asynchronous Ca2+ vesicle release (By similarity).
Required for the maintenance of synaptic ultrastructure in the adult retina (By similarity).
Positively regulates synaptic transmission through synaptic vesicle availability and exocytosis of neurotransmitters at photoreceptor ribbon synapses in the retina (By similarity).
Suppresses tonic photoreceptor activity and baseline 'noise' by suppression of Ca2+ vesicle tonic release and the facilitation of evoked synchronous and asynchronous Ca2+ vesicle release (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | photoreceptor ribbon synapse | |
Cellular Component | presynaptic active zone membrane | |
Cellular Component | SNARE complex | |
Cellular Component | synaptic vesicle membrane | |
Cellular Component | terminal bouton | |
Molecular Function | neurotransmitter transmembrane transporter activity | |
Molecular Function | SNARE binding | |
Molecular Function | syntaxin binding | |
Biological Process | insulin secretion | |
Biological Process | regulation of neurotransmitter secretion | |
Biological Process | regulation of synaptic vesicle fusion to presynaptic active zone membrane | |
Biological Process | synaptic vesicle exocytosis | |
Biological Process | visual perception |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameComplexin-3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8WVH0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor
Note: Enriched at the synaptic terminal (By similarity).
Localized at glycinergic synaptic contacts of AII amacrine cells with OFF cone bipolar cells in the OFF sublamina of the retina inner nuclear layer (By similarity).
Localized at glycinergic synaptic contacts of AII amacrine cells with OFF cone bipolar cells in the OFF sublamina of the retina inner nuclear layer (By similarity).
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 185 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000239272 | 1-155 | Complexin-3 | |||
Sequence: MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKC | ||||||
Modified residue | 155 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 155 | S-farnesyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000240233 | 156-158 | Removed in mature form | |||
Sequence: HVM |
Post-translational modification
Farnesylation mediates presynaptic targeting.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 13-47 | Disordered | ||||
Sequence: LKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEY | ||||||
Compositional bias | 24-47 | Basic and acidic residues | ||||
Sequence: EDKGDGDKSAAEAQGMSREEYEEY | ||||||
Coiled coil | 39-74 | |||||
Sequence: MSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRS | ||||||
Region | 74-99 | Disordered | ||||
Sequence: SHFRDKYRLPKNETDESQIQMAGGDV |
Sequence similarities
Belongs to the complexin/synaphin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length158
- Mass (Da)17,557
- Last updated2002-03-01 v1
- Checksum057B4DE06DB6EA0F
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 19 | in Ref. 4; BAB14805 | ||||
Sequence: S → G | ||||||
Compositional bias | 24-47 | Basic and acidic residues | ||||
Sequence: EDKGDGDKSAAEAQGMSREEYEEY |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY286501 EMBL· GenBank· DDBJ | AAP41127.1 EMBL· GenBank· DDBJ | mRNA | ||
AK074096 EMBL· GenBank· DDBJ | BAB84922.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AB072900 EMBL· GenBank· DDBJ | BAE45711.1 EMBL· GenBank· DDBJ | mRNA | ||
AK024055 EMBL· GenBank· DDBJ | BAB14805.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471136 EMBL· GenBank· DDBJ | EAW99306.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471136 EMBL· GenBank· DDBJ | EAW99307.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC018026 EMBL· GenBank· DDBJ | AAH18026.1 EMBL· GenBank· DDBJ | mRNA |