Q8WSF8 · Q8WSF8_APLCA
- ProteinSoluble acetylcholine receptor
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids236 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 18 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 18 | Mn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 94 | Mg2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 94 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 167 | Mg2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 170 | Mg2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 170 | Mg2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 170 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 183 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 204 | Mg2+ 6 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 210 | Mg2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 210 | Mg2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | neuron projection | |
Cellular Component | postsynapse | |
Molecular Function | excitatory extracellular ligand-gated monoatomic ion channel activity | |
Molecular Function | identical protein binding | |
Molecular Function | metal ion binding | |
Molecular Function | transmembrane signaling receptor activity | |
Molecular Function | transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Spiralia > Lophotrochozoa > Mollusca > Gastropoda > Heterobranchia > Euthyneura > Tectipleura > Aplysiida > Aplysioidea > Aplysiidae > Aplysia
Accessions
- Primary accessionQ8WSF8
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Chemistry
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MLVSVYLALLVACVGQAHS | ||||||
Chain | PRO_5004316614 | 20-236 | ||||
Sequence: QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD | ||||||
Glycosylation | 42 | N-acetyl-D-glucosamine 1 | ||||
Sequence: K | ||||||
Glycosylation | 87 | N-acetyl-D-glucosamine 2 | ||||
Sequence: N | ||||||
Glycosylation | 91 | N-acetyl-D-glucosamine 1 | ||||
Sequence: N | ||||||
Glycosylation | 91 | N-acetyl-D-glucosamine 2 | ||||
Sequence: N | ||||||
Glycosylation | 91 | N-acetyl-D-glucosamine 3 | ||||
Sequence: N | ||||||
Glycosylation | 91 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 144↔157 | |||||
Sequence: CDPTGVDSEEGATC | ||||||
Disulfide bond | 207↔208 | |||||
Sequence: CC |
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8WSF8 | - Q8WSF8 | 8 | EBI-7179765, EBI-7179765 | |
XENO | Q8WSF8 | P50984 | 2 | EBI-7179765, EBI-15553601 |
Protein-protein interaction databases
Chemistry
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-222 | Neurotransmitter-gated ion-channel ligand-binding | ||||
Sequence: PMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFR |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length236
- Mass (Da)26,568
- Last updated2002-03-01 v1
- Checksum6D0DE487C46707BE
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF322877 EMBL· GenBank· DDBJ | AAL37251.1 EMBL· GenBank· DDBJ | mRNA |