Q8W4C8 · ARL8C_ARATH
- ProteinADP-ribosylation factor-like protein 8c
- GeneARL8C
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids184 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
May play a role in lysosome motility. May play a role in chromosome segregation.
(Microbial infection) Component of tomato mosaic virus (ToMV) RNA replication complexes. Required for tobamovirus multiplication, especially for efficient negative-strand RNA synthesis and viral RNA capping.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | late endosome membrane | |
Cellular Component | lysosomal membrane | |
Cellular Component | plastid | |
Cellular Component | spindle | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | cell division | |
Biological Process | chromosome segregation | |
Biological Process | defense response to virus | |
Biological Process | protein transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameADP-ribosylation factor-like protein 8c
- Short namesAtARL8c
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8W4C8
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes with microtubules at the spindle mid-zone during mitosis.
Features
Showing features for intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Intramembrane | 1-18 | Note=Mediates targeting to membranes | ||||
Sequence: MGLWDSLLNWLRSLFFKQ |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
In the triple mutants arl8a-1 arl8b-1 arl8c-1, impaired multiplication of tomato mosaic virus (ToMV).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 8 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000438005 | 1-184 | ADP-ribosylation factor-like protein 8c | |||
Sequence: MGLWDSLLNWLRSLFFKQEMELSLVGLQNAGKTSLVNAIATGGYSEDMIPTVGFNMRKVTKGNVTIKIWDLGGQRRFRTMWERYCRGVSAIVYVIDAADRDSVPISRSELNDLLTKPSLNGIPLLILGNKIDKSEALSKQALVDQLGLESVTDREVCCYMISCKDSINIDAVIDWLIKHSRTAT |
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length184
- Mass (Da)20,573
- Last updated2002-03-01 v1
- ChecksumD3EE2D625E8C94CC
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8BCT8 | A0A1P8BCT8_ARATH | ARLA1A | 137 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB018107 EMBL· GenBank· DDBJ | BAB08314.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED94219.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY062658 EMBL· GenBank· DDBJ | AAL32736.1 EMBL· GenBank· DDBJ | mRNA | ||
AY114643 EMBL· GenBank· DDBJ | AAM47962.1 EMBL· GenBank· DDBJ | mRNA | ||
AY085271 EMBL· GenBank· DDBJ | AAM62503.1 EMBL· GenBank· DDBJ | mRNA |