Q8VYR0 · MCU2_ARATH
- ProteinCalcium uniporter protein 2, mitochondrial
- GeneMCU2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids293 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (By similarity).
Constitutes a pore-forming and calcium-conducting subunit (By similarity).
Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways (By similarity).
Constitutes a pore-forming and calcium-conducting subunit (By similarity).
Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways (By similarity).
Catalytic activity
- Ca2+(in) = Ca2+(out)
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Molecular Function | calcium channel activity | |
Molecular Function | metal ion binding | |
Biological Process | mitochondrial calcium ion homeostasis |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCalcium uniporter protein 2, mitochondrial
- Short namesAtMCU2
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8VYR0
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 168-188 | Helical; Name=1 | ||||
Sequence: ILWGGLGYSVVQIGIFVRLTF | ||||||
Transmembrane | 198-218 | Helical; Name=2 | ||||
Sequence: PITFFTTATGIIVGYAYFLMT |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-33 | Mitochondrion | ||||
Sequence: MWSVMGLVRRTAMSSTVNKASPVRSLLGGFRCL | ||||||
Chain | PRO_0000431374 | 34-293 | Calcium uniporter protein 2, mitochondrial | |||
Sequence: NVESKEEDEKKDMTVLEAKKLMRLVNVEDMKKKLIGMGDKEMVTYTTLIEASQGLGIARSLDEAHAFARVLDDAGVILIFRDKVYLHPHKVVDLIRKAVPLGLNPDDELIREEFDKMRSMKEEIDVLAHQQVRKILWGGLGYSVVQIGIFVRLTFWEFSWDVMEPITFFTTATGIIVGYAYFLMTSRDPTYQDFMKRLFLSRQRKLLKSHKFDAERFKELENKWKITSCSSSSCHANASIRNRVGVDLDLEDSLQSHHRD |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 193-201 | Selectivity filter | ||||
Sequence: WDVMEPITF |
Sequence similarities
Belongs to the MCU (TC 1.A.77) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 1 isoforms produced by Alternative splicing. A number of isoforms are produced. According to EST sequences.
Q8VYR0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length293
- Mass (Da)33,685
- Last updated2002-03-01 v1
- Checksum3F599D18C29038D7
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A8MR98 | A8MR98_ARATH | MCU2 | 214 |
Sequence caution
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC079733 EMBL· GenBank· DDBJ | AAG50752.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
CP002684 EMBL· GenBank· DDBJ | AEE33441.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE33442.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY070082 EMBL· GenBank· DDBJ | AAL49777.1 EMBL· GenBank· DDBJ | mRNA |