Q8VYF7 · WHY2_ARATH
- ProteinSingle-stranded DNA-binding protein WHY2, mitochondrial
- GeneWHY2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids238 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo.
Miscellaneous
Plants over-expressing WHY2 are small with dark-green distorted leaves, exhibit early senescence and produces shorter siliques with half the amount of seeds found in wild-type plants.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | DNA repair complex | |
Cellular Component | mitochondrion | |
Molecular Function | DNA binding | |
Molecular Function | mRNA binding | |
Molecular Function | single-stranded DNA binding | |
Biological Process | defense response | |
Biological Process | DNA repair | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSingle-stranded DNA-binding protein WHY2, mitochondrial
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8VYF7
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype under normal growth conditions.
Variants

We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 18 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-29 | Mitochondrion | ||||
Sequence: MMKQARSLLSRSLCDQSKSLFEASTLRGF | ||||||
Chain | PRO_0000420448 | 30-238 | Single-stranded DNA-binding protein WHY2, mitochondrial | |||
Sequence: ASWSNSSTPGRGFPGKDAAKPSGRLFAPYSIFKGKAALSVEPVLPSFTEIDSGNLRIDRRGSLMMTFMPAIGERKYDWEKKQKFALSPTEVGSLISMGSKDSSEFFHDPSMKSSNAGQVRKSLSVKPHADGSGYFISLSVNNSILKTNDYFVVPVTKAEFAVMKTAFSFALPHIMGWNRLTGHVNTEALPSRNVSHLKTEPQLELEWDK |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Homotetramer.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8VYF7 | GWD1 Q9SAC6 | 3 | EBI-15219982, EBI-2355356 |
Complex viewer
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 62-67 | Required for ssDNA binding | ||||
Sequence: KGKAAL |
Sequence similarities
Belongs to the Whirly family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length238
- Mass (Da)26,295
- Last updated2002-03-01 v1
- ChecksumF5586CABDABF4E02
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC016162 EMBL· GenBank· DDBJ | AAG51881.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
CP002684 EMBL· GenBank· DDBJ | AEE35181.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY072110 EMBL· GenBank· DDBJ | AAL59932.1 EMBL· GenBank· DDBJ | mRNA | ||
AY122961 EMBL· GenBank· DDBJ | AAM67494.1 EMBL· GenBank· DDBJ | mRNA | ||
AB493532 EMBL· GenBank· DDBJ | BAH30370.1 EMBL· GenBank· DDBJ | mRNA |