Q8VHI8 · SEC20_RAT
- ProteinVesicle transport protein SEC20
- GeneBnip1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids228 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
As part of a SNARE complex may be involved in endoplasmic reticulum membranes fusion and be required for the maintenance of endoplasmic reticulum organization. Also plays a role in apoptosis. It is for instance required for endoplasmic reticulum stress-induced apoptosis. As a substrate of RNF185 interacting with SQSTM1, might also be involved in mitochondrial autophagy.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COPI-coated vesicle | |
Cellular Component | cytoplasm | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | mitochondrial membrane | |
Cellular Component | mitochondrial outer membrane | |
Cellular Component | nuclear envelope | |
Cellular Component | SNARE complex | |
Molecular Function | calcium-induced calcium release activity | |
Molecular Function | SNAP receptor activity | |
Biological Process | apoptotic process | |
Biological Process | apoptotic process in response to mitochondrial fragmentation | |
Biological Process | endoplasmic reticulum membrane fusion | |
Biological Process | endoplasmic reticulum organization | |
Biological Process | protein transport | |
Biological Process | response to activity | |
Biological Process | response to oxygen-glucose deprivation | |
Biological Process | response to starvation | |
Biological Process | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameVesicle transport protein SEC20
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ8VHI8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass type IV membrane protein
Mitochondrion membrane ; Single-pass type IV membrane protein
Note: Localization to the mitochondrion is regulated by RNF186.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-199 | Cytoplasmic | ||||
Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSELTELNTKVKEKFQQLKHRIQELEQSAKEQDKESEKQLLLQEVENHKKQMLSNQTSWRKANLTCKLAIDNLEKAELLQGGDSLRQRKTTKESLAQTSSTITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLITKYNRREL | ||||||
Transmembrane | 200-220 | Helical; Anchor for type IV membrane protein | ||||
Sequence: TDKLLIFLALALFLATVLYIV | ||||||
Topological domain | 221-228 | Lumenal | ||||
Sequence: KKRLFPFL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000232418 | 1-228 | Vesicle transport protein SEC20 | |||
Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSELTELNTKVKEKFQQLKHRIQELEQSAKEQDKESEKQLLLQEVENHKKQMLSNQTSWRKANLTCKLAIDNLEKAELLQGGDSLRQRKTTKESLAQTSSTITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL |
Post-translational modification
Polyubiquitinated. 'Lys-63'-linked polyubiquitination by RNF185 increases the interaction with the autophagy receptor SQSTM1. Undergoes 'Lys-29'- and 'Lys-63'-linked polyubiquitination by RNF186 that may regulate BNIP1 localization to the mitochondrion.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B. Interacts directly with STX18, RINT1/TIP20L and NAPA. Interacts with ZW10 through RINT1. Interacts with BCL2. Interacts with RNF186. Interacts with RNF185. Interacts with SQSTM1; increased by 'Lys-63'-linked polyubiquitination of BNIP1.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 37-90 | |||||
Sequence: LSELTELNTKVKEKFQQLKHRIQELEQSAKEQDKESEKQLLLQEVENHKKQMLS |
Sequence similarities
Belongs to the SEC20 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length228
- Mass (Da)26,170
- Last updated2002-03-01 v1
- Checksum5F2CFED85E18824E
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6AJX7 | A0A8I6AJX7_RAT | Bnip1 | 217 | ||
A0A8I5ZK41 | A0A8I5ZK41_RAT | Bnip1 | 194 | ||
A0A8L2QGT1 | A0A8L2QGT1_RAT | Bnip1 | 209 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF454391 EMBL· GenBank· DDBJ | AAL50991.1 EMBL· GenBank· DDBJ | mRNA |