Q8VFT4 · OR4M1_MOUSE
- ProteinOlfactory receptor 4M1
- GeneOr4m1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids313 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Olfactory receptor that acts as a receptor of Asprosin hormone at the surface of hepatocytes to promote hepatocyte glucose release (PubMed:31230984).
Also binds Asprosin in the arcuate nucleus of the hypothalamus, thereby stimulating appetite by promoting orexigenic AgRP neuronal activity (PubMed:32337066).
In testis, Asprosin-binding promotes sperm progressive motility and enhances male fertility (PubMed:31798959).
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase, resulting in an elevation of intracellular cAMP (PubMed:31230984).
Also binds Asprosin in the arcuate nucleus of the hypothalamus, thereby stimulating appetite by promoting orexigenic AgRP neuronal activity (PubMed:32337066).
In testis, Asprosin-binding promotes sperm progressive motility and enhances male fertility (PubMed:31798959).
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase, resulting in an elevation of intracellular cAMP (PubMed:31230984).
Miscellaneous
The mouse olfactory receptor 4M1 (Q8VFT4) is not the one to one ortholog of human OR4M1 (Q8NGD0).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Molecular Function | G protein-coupled receptor activity | |
Molecular Function | olfactory receptor activity | |
Biological Process | adenylate cyclase-activating G protein-coupled receptor signaling pathway | |
Biological Process | G protein-coupled receptor signaling pathway | |
Biological Process | glucose homeostasis | |
Biological Process | positive regulation of appetite | |
Biological Process | positive regulation of flagellated sperm motility | |
Biological Process | sensory perception of smell |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameOlfactory receptor 4M1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8VFT4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-25 | Extracellular | ||||
Sequence: MEPANDTTVTEFILTGLSQTREVQL | ||||||
Transmembrane | 26-46 | Helical; Name=1 | ||||
Sequence: VLFVIFLSFYLFILPVNILII | ||||||
Topological domain | 47-57 | Cytoplasmic | ||||
Sequence: CTIRLDSHLSS | ||||||
Transmembrane | 58-78 | Helical; Name=2 | ||||
Sequence: PMYFLLANLAFLDIWYSSITA | ||||||
Topological domain | 79-97 | Extracellular | ||||
Sequence: PKMLVDFFVERKIISFGGC | ||||||
Transmembrane | 98-118 | Helical; Name=3 | ||||
Sequence: IAQLFFLHFVGASEMFLLTVM | ||||||
Topological domain | 119-142 | Cytoplasmic | ||||
Sequence: AFDRYAAICRPLHYATIMNRRLCC | ||||||
Transmembrane | 143-163 | Helical; Name=4 | ||||
Sequence: ILVALSWTGGFVHSIIQVALI | ||||||
Topological domain | 164-204 | Extracellular | ||||
Sequence: VRLPFCGPNELDNYFCDITQVVRIACANTFLEEMVMIFSSG | ||||||
Transmembrane | 205-225 | Helical; Name=5 | ||||
Sequence: LISVVCFIALLMSYAFLLTML | ||||||
Topological domain | 226-238 | Cytoplasmic | ||||
Sequence: KKHSSSGESTSRA | ||||||
Transmembrane | 239-259 | Helical; Name=6 | ||||
Sequence: ISTCYSHITIVVLMFGPSIYI | ||||||
Topological domain | 260-270 | Extracellular | ||||
Sequence: YARPFDSFSLD | ||||||
Transmembrane | 271-291 | Helical; Name=7 | ||||
Sequence: KVVSVFHTVIFPLLNPIIYTL | ||||||
Topological domain | 292-313 | Cytoplasmic | ||||
Sequence: RNKEVKAAMRKLVNRYIFCKEK |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Compared to wild-type mice, mutant mice fed on a regular diet show a remarkable decrease in body weight, food intake, fat mass and plasma lipids (PubMed:31230984).
Blunted response to Asprosin, including attenuated cAMP levels and hepatic glucose production, as well as improved insulin sensitivity (PubMed:31230984).
Mutant mice show significantly reduced food intake in overnight-fasted mice compared with wild-type mice (PubMed:32337066).
Male mice display decreased fertility caused by impaired sperm motility (PubMed:31798959).
Blunted response to Asprosin, including attenuated cAMP levels and hepatic glucose production, as well as improved insulin sensitivity (PubMed:31230984).
Mutant mice show significantly reduced food intake in overnight-fasted mice compared with wild-type mice (PubMed:32337066).
Male mice display decreased fertility caused by impaired sperm motility (PubMed:31798959).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 173 | Reduced affinity for Asprosin. | ||||
Sequence: E → A | ||||||
Mutagenesis | 186 | Reduced affinity for Asprosin. | ||||
Sequence: R → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 17 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000453783 | 1-313 | Olfactory receptor 4M1 | |||
Sequence: MEPANDTTVTEFILTGLSQTREVQLVLFVIFLSFYLFILPVNILIICTIRLDSHLSSPMYFLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGASEMFLLTVMAFDRYAAICRPLHYATIMNRRLCCILVALSWTGGFVHSIIQVALIVRLPFCGPNELDNYFCDITQVVRIACANTFLEEMVMIFSSGLISVVCFIALLMSYAFLLTMLKKHSSSGESTSRAISTCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKAAMRKLVNRYIFCKEK | ||||||
Glycosylation | 5 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 97↔179 | |||||
Sequence: CIAQLFFLHFVGASEMFLLTVMAFDRYAAICRPLHYATIMNRRLCCILVALSWTGGFVHSIIQVALIVRLPFCGPNELDNYFC |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Sequence
- Sequence statusComplete
- Length313
- Mass (Da)35,601
- Last updated2002-03-01 v1
- Checksum5A73BDE2898D6A5F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY073432 EMBL· GenBank· DDBJ | AAL61095.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY317859 EMBL· GenBank· DDBJ | AAP71197.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC141029 EMBL· GenBank· DDBJ | AAI41030.1 EMBL· GenBank· DDBJ | mRNA |