Q8VEA6 · CRDL2_MOUSE
- ProteinChordin-like protein 2
- GeneChrdl2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids426 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Implicated in tumor angiogenesis (By similarity).
May inhibits BMPs activity by blocking their interaction with their receptors. Has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. May play a role during myoblast and osteoblast differentiation, and maturation
May inhibits BMPs activity by blocking their interaction with their receptors. Has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. May play a role during myoblast and osteoblast differentiation, and maturation
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | BMP binding | |
Biological Process | cell differentiation | |
Biological Process | chondrocyte differentiation | |
Biological Process | negative regulation of BMP signaling pathway | |
Biological Process | ossification |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameChordin-like protein 2
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8VEA6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MVPGVRIIPSLLGLVMFWLPLDSQA | ||||||
Chain | PRO_0000005372 | 26-426 | Chordin-like protein 2 | |||
Sequence: RSRSGKVCLFGEKIYTPGQSWHPYLEPQGTIYCVRCTCSENGHVNCYRLRCPPLHCSQPVMEPQQCCPRCVDPHVPSGLRVPLKSCQLNETTYQHGEIFSAQELFPARLSNQCVLCSCIEGHTYCGLMTCPEPSCPTTLPLPDSCCQTCKDRTTESSTEENLTQLQHGERHSQDPCSERRGPSTPAPTSLSSPLGFIPRHFQSVGMGSTTIKIILKEKHKKACTHNGKTYSHGEVWHPTVLSFGPMPCILCTCIDGYQDCHRVTCPTQYPCSQPKKVAGKCCKICPEDEAEDDHSEVISTRCPKVPGQFHVYTLASPSPDSLHRFVLEHEASDQVEMYIWKLVKGIYHLVQIKRVRKQDFQKEAQNFRLLTGTHEGYWTVFLAQTPELKVTASPDKVTKTL | ||||||
Glycosylation | 114 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 182 | Phosphoserine | ||||
Sequence: S | ||||||
Glycosylation | 186 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Weakly expressed in the liver and kidney. In reproductive organs expressed in connective tissues such as ligaments of the ovary and oviduct in females, and of testis, epididymis and certain male accessory sex glands in males. Expression was high in uterine myometrium. Weakly expressed in cartilage of the femoral head, patella, articular facets of vertebrae, in the annulus fibrosus of intervertebral disks. In normal cartilage, expression was confined to articular chondrocytes especially in the superficial zone.
Developmental stage
In embryo expressed to the surface chondrocytes of developing joint cartilage and to the connective tissue of reproductive organs.
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 31-96 | VWFC 1 | ||||
Sequence: KVCLFGEKIYTPGQSWHPYLEPQGTIYCVRCTCSENGHVNCYRLRCPPLHCSQPVMEPQQCCPRCV | ||||||
Domain | 109-175 | VWFC 2 | ||||
Sequence: KSCQLNETTYQHGEIFSAQELFPARLSNQCVLCSCIEGHTYCGLMTCPEPSCPTTLPLPDSCCQTCK | ||||||
Region | 182-216 | Disordered | ||||
Sequence: STEENLTQLQHGERHSQDPCSERRGPSTPAPTSLS | ||||||
Domain | 246-311 | VWFC 3 | ||||
Sequence: KACTHNGKTYSHGEVWHPTVLSFGPMPCILCTCIDGYQDCHRVTCPTQYPCSQPKKVAGKCCKICP |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 1 isoforms produced by Alternative splicing. Additional isoforms seem to exist. Differential expression of isoforms was observed during myoblast and osteoblast differentiation and maturation.
Q8VEA6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length426
- Mass (Da)47,765
- Last updated2002-03-01 v1
- Checksum45BAB7BEE09AFE04
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D3YV59 | D3YV59_MOUSE | Chrdl2 | 433 | ||
A0A0B4J1E8 | A0A0B4J1E8_MOUSE | Chrdl2 | 426 | ||
F6WCT1 | F6WCT1_MOUSE | Chrdl2 | 221 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 26 | in Ref. 2; AAK50575 | ||||
Sequence: R → L | ||||||
Sequence conflict | 335 | in Ref. 2; AAK50575 | ||||
Sequence: H → Q |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF338222 EMBL· GenBank· DDBJ | AAK50575.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
BC019399 EMBL· GenBank· DDBJ | AAH19399.1 EMBL· GenBank· DDBJ | mRNA |