Q8VDR9 · DOCK6_MOUSE
- ProteinDedicator of cytokinesis protein 6
- GeneDock6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids2080 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Acts as a guanine nucleotide exchange factor (GEF) for CDC42 and RAC1 small GTPases (By similarity).
Through its activation of CDC42 and RAC1, regulates neurite outgrowth in an vitro differentiation system
Through its activation of CDC42 and RAC1, regulates neurite outgrowth in an vitro differentiation system
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | perinuclear region of cytoplasm | |
Molecular Function | guanyl-nucleotide exchange factor activity | |
Biological Process | small GTPase-mediated signal transduction |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDedicator of cytokinesis protein 6
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8VDR9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Mainly located near the cell surface.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000189994 | 1-2080 | Dedicator of cytokinesis protein 6 | |||
Sequence: MAASERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRSSSSLGVPLTEVIEPLDFEDVLLSRPPEVEPGPLRDLIEFPVDDLELLKQPRECRTTESGVPEDGQLDAQVRAAVEMYSEDWVIVRRRYQHLSTAYSPITTETQREWQKGLTCQVFEQDTPGDERTGPEDVDDPQHCSGSPEDTPRSSGASGIFSLRNLAADSLLPTLLEQAAPEDVDRRNEALRRQHRAPTLLTLYPAPDEDEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGTLALYDVREKKKISENFYFDLNSDSVKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVVKLEKVLQQGDISECCEPYMVMKEADTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSRPQDRDSDSEGERRPTWAERRRRGPQDRGYSGDDACSFSSFRPATLTVTNFFKQEAERLSDEDLFKFLADMRRPSSLLRRLRPVTAQLKLDISPAPENLHFCLSPDLLHVKPYPDPRGRPTKEILEFPAREVYAPHSCYRNLLFVYPHSLNFSSRQGSVRNLAVRIQYMAGEDQSQALPVIFGKSSCSEFTREAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLFFTFYHVSCQPRPGTALETPVGFTWIPLLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQDPHLDKFFTLVHVLEEGIFPFRLKETVLSEGTMEQELRASLAALRLASPEPLVAFSHLVLDKLVRLVVRPPIICGQMVNLGRGAFEAMAHVASLVHRNLEAVQDSRGHCPLLASYVHYAFRLPGGDLSLPGEAPPATVQAATLARGSGRPASLYLARSKSISSSNPDLAVVPGSVDDEVSRILASKGVDRSHSWVNSAYAPGGSKAVLRRVPPYCGADPRQLLHEELALQWVVSGSAVRELVLQHAWFFFQLMVKSMELHLLLGQRLDTPRKLRFPGRFLDDIAALVASVGLEVITRVHKDMKLAERLNASLAFFLSDLLSIADRGYIFSLVRAHYKQVATRLQSAPNPTALLTLRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSVSSTTSQSSTFSSQAPDPKVTSMFELSGPFRQQHFLSGLLLTELALALDPEAEGASLLHKKAISAVHSLLCSHDVDSRYAEATVKAKVAELYLPLLSLARDTLPQLHGFAEGSGQRSRLASMLDSDTEGEGDIGSTINPSVAMAIAGGPLAPGSRTSISQGPSTAARSGCPLSAESSRTLLVCVLWVLKNAEPTLLQRWAADLALPQLGRLLDLLYLCLAAFEYKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPFGNQENVRWRKSATHWRQTSDRVDKTKDEMEHEALVDGNLATEASLVVLDTLETIVQTVMLSEARESILSAVLKVVLYSLGSAQSALFLQHGLATQRALVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRMHASASLYLLMRQNFEIGHNFARVKMLVTMSLSSLVGTTQNFSEEHLRKSLKTILTYAEEDIGLRDSTFAEQVQDLMFNLHMILTDTVKMKEHQEDPEMLMDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNVSSNVLEESAISDDILSPDEEGFCSGKNFTELGLVGLLEQAAGYFTMGGLYEAVNEVYKNLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQSSGWERVFGTYFRVGFYGTRFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFGDDVVEIIKDSNPVDKSKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRAFLFCTPFTPDGRAHGELAEQHKRKTLLSTEHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLSEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERHYSRLREALQPLLTQRLPQLLAPSSTSLRSSMNRSSFRKADL | ||||||
Modified residue | 178 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 863 | Omega-N-methylarginine | ||||
Sequence: R | ||||||
Modified residue | 870 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 878 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 882 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1341 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 2064 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 2065 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 2069 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed with highest levels in lung and heart.
Induction
Up-regulated during differentiation of the N1E-115 neuroblastoma cell line.
Developmental stage
Expressed at 9.5 dpc in the growing edge of the limb buds and in the developing heart. At 10.5 dpc, strongly expressed at the edge of the limb buds, while expression in the heart maintained. At 11.5 dpc, detected in the apical ectodermal ridge of all 4 limbs, with higher expression in hindlimbs than in forelimbs. By 12.5 and 13.5 dpc, expression pattern more diffused in the limbs. At 13.5 dpc, clearly observed in the developing digits.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 20-34 | Basic and acidic residues | ||||
Sequence: EVRKQVSRERSGSPH | ||||||
Region | 20-44 | Disordered | ||||
Sequence: EVRKQVSRERSGSPHSSRRSSSSLG | ||||||
Region | 156-189 | Disordered | ||||
Sequence: QDTPGDERTGPEDVDDPQHCSGSPEDTPRSSGAS | ||||||
Compositional bias | 160-177 | Basic and acidic residues | ||||
Sequence: GDERTGPEDVDDPQHCSG | ||||||
Compositional bias | 408-435 | Basic and acidic residues | ||||
Sequence: PQDRDSDSEGERRPTWAERRRRGPQDRG | ||||||
Region | 408-441 | Disordered | ||||
Sequence: PQDRDSDSEGERRPTWAERRRRGPQDRGYSGDDA | ||||||
Domain | 546-712 | C2 DOCK-type | ||||
Sequence: RNLLFVYPHSLNFSSRQGSVRNLAVRIQYMAGEDQSQALPVIFGKSSCSEFTREAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLFFTFYHVSCQPRPGTALETPVGFTWIPLLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAV | ||||||
Region | 1101-1123 | Disordered | ||||
Sequence: ASPSPSVSSTTSQSSTFSSQAPD | ||||||
Compositional bias | 1104-1123 | Polar residues | ||||
Sequence: SPSVSSTTSQSSTFSSQAPD | ||||||
Domain | 1620-2056 | DOCKER | ||||
Sequence: RGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNVSSNVLEESAISDDILSPDEEGFCSGKNFTELGLVGLLEQAAGYFTMGGLYEAVNEVYKNLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQSSGWERVFGTYFRVGFYGTRFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFGDDVVEIIKDSNPVDKSKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRAFLFCTPFTPDGRAHGELAEQHKRKTLLSTEHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLSEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERHYSRLREALQPLLTQRLP |
Domain
The DOCKER domain may mediate some GEF activity.
Sequence similarities
Belongs to the DOCK family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q8VDR9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length2,080
- Mass (Da)233,267
- Last updated2011-07-27 v4
- ChecksumAC9541FB05DB78D0
Q8VDR9-2
- Name2
- Differences from canonical
- 905-939: Missing
- 1019-1062: DMKLAERLNASLAFFLSDLLSIADRGYIFSLVRAHYKQVATRLQ → VRKDSAQGCSVVRDPVCHVGLFIHGLFLEHLWFTWPWLDVETQL
- 1063-2080: Missing
Q8VDR9-3
- Name3
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1L1ST98 | A0A1L1ST98_MOUSE | Dock6 | 577 | ||
A0A1L1STJ1 | A0A1L1STJ1_MOUSE | Dock6 | 477 | ||
A0A1L1SQR4 | A0A1L1SQR4_MOUSE | Dock6 | 2111 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 20-34 | Basic and acidic residues | ||||
Sequence: EVRKQVSRERSGSPH | ||||||
Sequence conflict | 145 | in Ref. 1; BAE26239 | ||||
Sequence: W → R | ||||||
Compositional bias | 160-177 | Basic and acidic residues | ||||
Sequence: GDERTGPEDVDDPQHCSG | ||||||
Alternative sequence | VSP_022257 | 241-244 | in isoform 3 | |||
Sequence: DEAV → VGAY | ||||||
Alternative sequence | VSP_022258 | 245-2080 | in isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 408-435 | Basic and acidic residues | ||||
Sequence: PQDRDSDSEGERRPTWAERRRRGPQDRG | ||||||
Alternative sequence | VSP_022259 | 905-939 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022260 | 1019-1062 | in isoform 2 | |||
Sequence: DMKLAERLNASLAFFLSDLLSIADRGYIFSLVRAHYKQVATRLQ → VRKDSAQGCSVVRDPVCHVGLFIHGLFLEHLWFTWPWLDVETQL | ||||||
Alternative sequence | VSP_022261 | 1063-2080 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 1104-1123 | Polar residues | ||||
Sequence: SPSVSSTTSQSSTFSSQAPD |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK016777 EMBL· GenBank· DDBJ | BAB30423.2 EMBL· GenBank· DDBJ | mRNA | ||
AK080190 EMBL· GenBank· DDBJ | BAC37843.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AK145109 EMBL· GenBank· DDBJ | BAE26239.1 EMBL· GenBank· DDBJ | mRNA | ||
AC161371 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC166992 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC021414 EMBL· GenBank· DDBJ | AAH21414.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC043042 EMBL· GenBank· DDBJ | AAH43042.1 EMBL· GenBank· DDBJ | mRNA | ||
BC057368 EMBL· GenBank· DDBJ | AAH57368.2 EMBL· GenBank· DDBJ | mRNA |