Q8VD04 · GRAP1_MOUSE
- ProteinGRIP1-associated protein 1
- GeneGripap1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids806 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulates the endosomal recycling back to the neuronal plasma membrane, possibly by connecting early and late recycling endosomal domains and promoting segregation of recycling endosomes from early endosomal membranes. Involved in the localization of recycling endosomes to dendritic spines, thereby playing a role in the maintenance of dendritic spine morphology. Required for the activity-induced AMPA receptor recycling to dendrite membranes and for long-term potentiation and synaptic plasticity (By similarity).
GRASP-1 C-terminal chain
Functions as a scaffold protein to facilitate MAP3K1/MEKK1-mediated activation of the JNK1 kinase by phosphorylation, possibly by bringing MAP3K1/MEKK1 and JNK1 in close proximity (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 563-564 | Cleavage; by caspase-3 | ||||
Sequence: DG |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | dendrite | |
Cellular Component | extrinsic component of postsynaptic early endosome membrane | |
Cellular Component | glutamatergic synapse | |
Cellular Component | neuronal cell body | |
Cellular Component | postsynaptic recycling endosome | |
Cellular Component | presynaptic membrane | |
Cellular Component | recycling endosome membrane | |
Cellular Component | Schaffer collateral - CA1 synapse | |
Molecular Function | guanyl-nucleotide exchange factor activity | |
Molecular Function | ionotropic glutamate receptor binding | |
Biological Process | negative regulation of protein localization | |
Biological Process | negative regulation of receptor clustering | |
Biological Process | neurotransmitter receptor transport, endosome to postsynaptic membrane | |
Biological Process | regulation of modification of synaptic structure | |
Biological Process | regulation of neurotransmitter receptor transport, endosome to postsynaptic membrane | |
Biological Process | regulation of recycling endosome localization within postsynapse |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameGRIP1-associated protein 1
- Short namesGRASP-1
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8VD04
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Early endosome membrane ; Peripheral membrane protein
Recycling endosome membrane ; Peripheral membrane protein
Note: Localizes to recycling endosomal tubules that are emanating from early endosomes.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000087582 | 2-806 | GRIP1-associated protein 1 | |||
Sequence: AQALSEEEFQRMQTQLLELRTNNYQLSDELRKNGVELSSLRQKVAYLDKEFSKAQKALSKSKKAQEVEVLLSENEMLQAKLHSQEEDFRLQNSTLMAEFSKLCSQLEQLELENRQLKEGVPGAAGAHVDGELLRLQAENTALQKNMAALQERYGKEAVRPSAVGEGQGDPPGDVLPTPLAPMPLAEVELKWEMEREEKKLLWEQLQGLESSKQAETSRLQEELAKLSEKLKKKQESFCRLQTEKETLFNDSRNKIEELQQRKEADLKAQLARTQKLQQELEAANQSLAELRDQRQGERLEHAAALRALQDQIQTAKTQELNMLREQTSELASELQHRQAEYEELMGQKDDLNSQLQESLRANSRLLEQLQEIGQEKEQLTQDLQEARKSAEKRKVMLDELAMETLQEKSQHKEELGAVRLRHEKELLGVRARYERELRELHEDKKRQEEELRGQIREEKARTRELENLQHTVEELQAQVHSMDGAKGWFERRLKEAEESLQQQQQEQEETLKLCREEHAAELKGKDEELQNVREQLQQAQEERDGHVKTISNLKQEVKDTVDGQRILEKKGSAVLKDLKRQLHLERKRADKLQERLQEILTNSKSRTGLEELVLSEMNSPSRTQTGDSSSVSSFSYREILKEKESSAIPARSLSSSPQAQPPRPAELSDEEVAELFQRLAETQQEKWMLEEKVKHLEVSSASMAEDLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGSPDPDLEPGEAN | ||||||
Chain | PRO_0000441812 | 564-806 | GRASP-1 C-terminal chain | |||
Sequence: GQRILEKKGSAVLKDLKRQLHLERKRADKLQERLQEILTNSKSRTGLEELVLSEMNSPSRTQTGDSSSVSSFSYREILKEKESSAIPARSLSSSPQAQPPRPAELSDEEVAELFQRLAETQQEKWMLEEKVKHLEVSSASMAEDLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGSPDPDLEPGEAN | ||||||
Modified residue | 620 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 631 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 633 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 634 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 653 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 655 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 656 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 657 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 795 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Proteolytically cleaved by caspase-3. A minor C-terminal proteolytic fragment of 30 kDa is produced. Proteolytic cleavage is required for JNK signaling activation.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the central nervous system, including cortex, cerebellum, midbrain and spinal cord, and in primary cultured hippocampal neurons but absent in non-neuronal tissues and cell types with the exception of neuroendocrine insulinoma cells.
Gene expression databases
Interaction
Subunit
Interacts with GRIP1, GRIP2 and AMPA receptors. Interacts (via C-terminus) with MAPK8/JNK1 and MAP3K1/MEKK1; the interaction promotes MAP3K1-mediated phosphorylation of MAPK8. Interacts (via N-terminus) with RAB4A (in GTP-bound form) (By similarity).
Interacts (via C-terminus) with STX12 (PubMed:20098723).
Interacts (via C-terminus) with STX12 (PubMed:20098723).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | Q8VD04 | DISC1 Q9NRI5 | 2 | EBI-7585099, EBI-529989 | |
BINARY | Q8VD04 | Mapk8 A3KBF5 | 2 | EBI-7585099, EBI-7585074 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 4-158 | |||||
Sequence: ALSEEEFQRMQTQLLELRTNNYQLSDELRKNGVELSSLRQKVAYLDKEFSKAQKALSKSKKAQEVEVLLSENEMLQAKLHSQEEDFRLQNSTLMAEFSKLCSQLEQLELENRQLKEGVPGAAGAHVDGELLRLQAENTALQKNMAALQERYGKEA | ||||||
Coiled coil | 204-606 | |||||
Sequence: EQLQGLESSKQAETSRLQEELAKLSEKLKKKQESFCRLQTEKETLFNDSRNKIEELQQRKEADLKAQLARTQKLQQELEAANQSLAELRDQRQGERLEHAAALRALQDQIQTAKTQELNMLREQTSELASELQHRQAEYEELMGQKDDLNSQLQESLRANSRLLEQLQEIGQEKEQLTQDLQEARKSAEKRKVMLDELAMETLQEKSQHKEELGAVRLRHEKELLGVRARYERELRELHEDKKRQEEELRGQIREEKARTRELENLQHTVEELQAQVHSMDGAKGWFERRLKEAEESLQQQQQEQEETLKLCREEHAAELKGKDEELQNVREQLQQAQEERDGHVKTISNLKQEVKDTVDGQRILEKKGSAVLKDLKRQLHLERKRADKLQERLQEILTNSKS | ||||||
Region | 616-635 | Disordered | ||||
Sequence: SEMNSPSRTQTGDSSSVSSF | ||||||
Region | 646-671 | Disordered | ||||
Sequence: SSAIPARSLSSSPQAQPPRPAELSDE | ||||||
Compositional bias | 649-663 | Polar residues | ||||
Sequence: IPARSLSSSPQAQPP | ||||||
Coiled coil | 666-700 | |||||
Sequence: AELSDEEVAELFQRLAETQQEKWMLEEKVKHLEVS | ||||||
Coiled coil | 750-779 | |||||
Sequence: DENLREMNKKLQNMLEEQLTKNMHLHKDME |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length806
- Mass (Da)92,715
- Last updated2002-03-01 v1
- Checksum766F7C5B44589020
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 4 | in Ref. 3; CAA66184 | ||||
Sequence: A → R | ||||||
Sequence conflict | 502 | in Ref. 1; BAE33608/BAE43101/BAE43133 | ||||
Sequence: Q → L | ||||||
Compositional bias | 649-663 | Polar residues | ||||
Sequence: IPARSLSSSPQAQPP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK156165 EMBL· GenBank· DDBJ | BAE33608.1 EMBL· GenBank· DDBJ | mRNA | ||
AK172623 EMBL· GenBank· DDBJ | BAE43101.1 EMBL· GenBank· DDBJ | mRNA | ||
AK172699 EMBL· GenBank· DDBJ | BAE43133.1 EMBL· GenBank· DDBJ | mRNA | ||
AL671995 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
X97571 EMBL· GenBank· DDBJ | CAA66184.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK173119 EMBL· GenBank· DDBJ | BAD32397.1 EMBL· GenBank· DDBJ | Transcribed RNA |