Q8TMG0 · ICMT_METAC
- ProteinProtein-S-isoprenylcysteine O-methyltransferase
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids194 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Carboxyl methyltransferase with activity toward prenyl lipids. In vitro, displays activity toward N-acetyl-S-farnesyl-L-cysteine (AFC) and S-farnesylthioacetic acid (FTA), an analog of AFC.
Catalytic activity
- [protein]-C-terminal S-[(2E,6E)-farnesyl]-L-cysteine + S-adenosyl-L-methionine = [protein]-C-terminal S-[(2E,6E)-farnesyl]-L-cysteine methyl ester + S-adenosyl-L-homocysteine
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 108 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 113-116 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: HKLV | ||||||
Binding site | 121 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 126-129 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: HPMY | ||||||
Binding site | 163 | substrate | ||||
Sequence: R | ||||||
Binding site | 167 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity | |
Biological Process | methylation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein-S-isoprenylcysteine O-methyltransferase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageArchaea > Euryarchaeota > Stenosarchaea group > Methanomicrobia > Methanosarcinales > Methanosarcinaceae > Methanosarcina
Accessions
- Primary accessionQ8TMG0
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1 | Extracellular | ||||
Sequence: M | ||||||
Transmembrane | 2-28 | Helical | ||||
Sequence: NENLWKICFIVMFIIWVFVRKVYGTRA | ||||||
Topological domain | 29-37 | Cytoplasmic | ||||
Sequence: MKNKSKKKV | ||||||
Transmembrane | 38-62 | Helical | ||||
Sequence: RPNFEKSLVFLNFIGMVFLPLTAVF | ||||||
Topological domain | 63-73 | Extracellular | ||||
Sequence: SSYLDSFNINL | ||||||
Transmembrane | 74-98 | Helical | ||||
Sequence: PDSIRLFALIVTFLNIGLFTKIHKD | ||||||
Topological domain | 99-125 | Cytoplasmic | ||||
Sequence: LGNNWSAILEIKDGHKLVKEGIYKNIR | ||||||
Transmembrane | 126-144 | Helical | ||||
Sequence: HPMYAHLWLWVITQGIILS | ||||||
Topological domain | 145 | Extracellular | ||||
Sequence: N | ||||||
Transmembrane | 146-166 | Helical | ||||
Sequence: WVVLIFGIVAWAILYFIRVPK | ||||||
Topological domain | 167-194 | Cytoplasmic | ||||
Sequence: EEELLIEEFGDEYIEYMGKTGRLFPKVV |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 113 | Abolishes FTA methylation. | ||||
Sequence: H → A | ||||||
Mutagenesis | 126 | Abolishes FTA methylation. | ||||
Sequence: H → A | ||||||
Mutagenesis | 163 | Abolishes FTA methylation. | ||||
Sequence: R → A | ||||||
Mutagenesis | 167 | Abolishes FTA methylation. | ||||
Sequence: E → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000449360 | 1-194 | Protein-S-isoprenylcysteine O-methyltransferase | |||
Sequence: MNENLWKICFIVMFIIWVFVRKVYGTRAMKNKSKKKVRPNFEKSLVFLNFIGMVFLPLTAVFSSYLDSFNINLPDSIRLFALIVTFLNIGLFTKIHKDLGNNWSAILEIKDGHKLVKEGIYKNIRHPMYAHLWLWVITQGIILSNWVVLIFGIVAWAILYFIRVPKEEELLIEEFGDEYIEYMGKTGRLFPKVV |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the class VI-like SAM-binding methyltransferase superfamily. Isoprenylcysteine carboxyl methyltransferase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length194
- Mass (Da)22,811
- Last updated2002-06-01 v1
- Checksum11A8176F4E8B4EA9
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE010299 EMBL· GenBank· DDBJ | AAM06077.1 EMBL· GenBank· DDBJ | Genomic DNA |