Q8S925 · ATG8H_ARATH
- ProteinAutophagy-related protein 8h
- GeneATG8H
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids119 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Ubiquitin-like modifier involved in autophagosomes formation. May mediate the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | autophagosome | |
Cellular Component | autophagosome membrane | |
Cellular Component | cytoplasmic vesicle | |
Cellular Component | microtubule | |
Biological Process | autophagy | |
Biological Process | protein transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAutophagy-related protein 8h
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8S925
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, autophagosome membrane ; Lipid-anchor
Vacuole membrane ; Lipid-anchor
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000286919 | 1-119 | Autophagy-related protein 8h | |||
Sequence: MGIVVKSFKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTVGHFIHMLSKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG | ||||||
Lipidation | 119 | Phosphatidylethanolamine amidated glycine | ||||
Sequence: G |
Post-translational modification
Gly-119 forms then a thioester bond with the 'Cys-558' of ATG7 (E1-like activating enzyme) before being transferred to the 'Cys-258' of ATG3 (the specific E2 conjugating enzyme), in order to be finally amidated with phosphatidylethanolamine. This lipid modification anchors ATG8 to autophagosomes.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Constitutively expressed.
Induction
Induced by sugar starvation.
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length119
- Mass (Da)13,884
- Last updated2002-06-01 v1
- Checksum25F4AF1E247E02F3
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB073182 EMBL· GenBank· DDBJ | BAB88394.1 EMBL· GenBank· DDBJ | mRNA | ||
AC011623 EMBL· GenBank· DDBJ | AAF08574.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE74390.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK175289 EMBL· GenBank· DDBJ | BAD43052.1 EMBL· GenBank· DDBJ | mRNA | ||
AK176187 EMBL· GenBank· DDBJ | BAD43950.1 EMBL· GenBank· DDBJ | mRNA | ||
AK176657 EMBL· GenBank· DDBJ | BAD44420.1 EMBL· GenBank· DDBJ | mRNA | ||
BT024566 EMBL· GenBank· DDBJ | ABD38905.1 EMBL· GenBank· DDBJ | mRNA | ||
AY085270 EMBL· GenBank· DDBJ | AAM62502.1 EMBL· GenBank· DDBJ | mRNA |