Q8S7T9 · Q8S7T9_ORYSJ
- ProteinFatty acyl-CoA reductase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids608 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.
Catalytic activity
- a long-chain fatty acyl-CoA + 2 H+ + 2 NADPH = a long-chain primary fatty alcohol + CoA + 2 NADP+
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 99 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 100 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 101 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 102 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 103 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 126 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 136 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 172 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 173 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 198 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 200 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 202 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 326 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 350 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: I |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | intracellular membrane-bounded organelle | |
Molecular Function | alcohol-forming long-chain fatty acyl-CoA reductase activity | |
Molecular Function | alcohol-forming very long-chain fatty acyl-CoA reductase activity | |
Molecular Function | nucleotide binding | |
Biological Process | long-chain fatty-acyl-CoA metabolic process | |
Biological Process | pollen exine formation | |
Biological Process | suberin biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFatty acyl-CoA reductase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ8S7T9
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 96-403 | Thioester reductase (TE) | ||||
Sequence: ITGGTGFLAKVLIEKILRTNPDVGKIYVLIKAKDGDAALKRLHNEVVDTELFSRLQEIHGKDYHSFAARKLVPVVGDVREANVGIAPELAGVIADEVDIIVNSAANTTFDERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGVVLEKPFRLGDTIAKELGSPDSSQHKNTMLDIEAEIKLAFDHRRHGDDSASFSEEMKELGLERAKLHGWQDTYVFTKAMGEMVINSMRGDIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGKGQLSGFLADPEGVLDVVPADMVVNAT | ||||||
Domain | 522-584 | Fatty acyl-CoA reductase C-terminal | ||||
Sequence: YLGSIYQPYTFYGGRFDNGNTEALIGEMSEEEKARFHFDVRSIEWTDYITNVHIPGLRKHVMK | ||||||
Region | 588-608 | Disordered | ||||
Sequence: VGGGSGASSSSNASLLAGASV | ||||||
Compositional bias | 591-608 | Polar residues | ||||
Sequence: GSGASSSSNASLLAGASV |
Sequence similarities
Belongs to the fatty acyl-CoA reductase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length608
- Mass (Da)65,228
- Last updated2002-06-01 v1
- Checksum01BC2647779D5AB7
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 591-608 | Polar residues | ||||
Sequence: GSGASSSSNASLLAGASV |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DP000009 EMBL· GenBank· DDBJ | ABF94174.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK121254 EMBL· GenBank· DDBJ | BAH00399.1 EMBL· GenBank· DDBJ | mRNA | ||
AP014959 EMBL· GenBank· DDBJ | BAS82489.1 EMBL· GenBank· DDBJ | Genomic DNA |