Q8RXD9 · DPE2_ARATH
- Protein4-alpha-glucanotransferase DPE2
- GeneDPE2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids955 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytosolic alpha-glucanotransferase essential for the cytosolic metabolism of maltose, an intermediate on the pathway by which starch is converted to sucrose in leaves at night. Metabolizes maltose exported from the chloroplast and is specific for beta-maltose. May play a role in freezing tolerance. Temperature drop induces inactivation of DPE2 that leads to rapid accumulation of maltose, a solute that protects cells from freezing damage.
Catalytic activity
Activity regulation
Inactivated in response to cold stress.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | 4-alpha-glucanotransferase activity | |
Molecular Function | beta-maltose 4-alpha-glucanotransferase activity | |
Molecular Function | heteropolysaccharide binding | |
Molecular Function | starch binding | |
Biological Process | maltose catabolic process | |
Biological Process | maltose metabolic process | |
Biological Process | polysaccharide metabolic process | |
Biological Process | starch catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended name4-alpha-glucanotransferase DPE2
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8RXD9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Dwarf plants with yellowish leaves that accumulate large amounts of maltose. Increased tolerance to cold.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 55 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000407919 | 1-955 | 4-alpha-glucanotransferase DPE2 | |||
Sequence: MMNLGSLSLSTSKSSKPMVSISFWIPYFTHWGESLLVCGSAPGLGSGNVKKGLLLKPSQQDDQLIWSGSVSVPPGFSSDYCYYVVDDSKSVLRSEFGMKRKLVVPETLTGGESVHLRDLWQSGDQALPFRSAFKDVIFHHSFDVKVEKPLGVFMNKSDQDDSVVVQFKICCPDIGEGTSVYVLGTPEKLGNWKVENGLRLNYVDDSIWEADCLIPKADFPIKYRYCKVQKEDSIGFESGGNRELSLHSIGSKQEYIVMSDGLFRAMPWRGAGVAVPMFSVRSEDDVGVGEFLDLKLLVDWAVDSGLHLVQLLPVNDTSVHKMWWDSYPYSSLSVFALHPLYLRVQALSERLPEDIKEEIQKAKNQLDKNDVDYEATMETKLSIAKKIFDIEKDQTLNSSTFQKFFSENEGWLKPYAAFCFLRDFFETSDHSQWGTFSDYTDDKLEKLISKDNLHYNTICFHYYIQYHLHVQLSAAAEYARKKGVVLKGDLPIGVDRNSVDTWVYRNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNYAWWRARLTQMGKYFTAYRIDHILGFFRIWELPAHAMTGLVGKFRPSIPLSQEELEKEGIWDFDRLSKPYIQKKFLEEKFGDFWPFIASNFLNETQKDMYEFKEDCNTEKKIVAKLKSLAEKSLLLENEDKVRRDVFDILRNVVLIKDPEDARKFYPRFNIEDTSSFQDLDDHSKNVLKRLYYDYYFQRQEDLWRKNALKTLPALLNSSNMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPSESDVKFGIPSNYDYMTVCAPSCHDCSTLRAWWEEDEERRQQYFKEVIGVDGIPPSQCIPEITHFILRQHVEAPSMWAIFPLQDMMALKEEYTTRPATEETINDPTNPKHYWRYRVHVTLDSLLKDTDLKSTIKNLVSSSGRSVPANVSGEDINKSRGEVIANGSTKPNP |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
Circadian-regulation with a peak in expression in the middle of the light period.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 13-122 | CBM20 1 | ||||
Sequence: KSSKPMVSISFWIPYFTHWGESLLVCGSAPGLGSGNVKKGLLLKPSQQDDQLIWSGSVSVPPGFSSDYCYYVVDDSKSVLRSEFGMKRKLVVPETLTGGESVHLRDLWQS | ||||||
Domain | 157-270 | CBM20 2 | ||||
Sequence: SDQDDSVVVQFKICCPDIGEGTSVYVLGTPEKLGNWKVENGLRLNYVDDSIWEADCLIPKADFPIKYRYCKVQKEDSIGFESGGNRELSLHSIGSKQEYIVMSDGLFRAMPWRG | ||||||
Region | 925-955 | Disordered | ||||
Sequence: SGRSVPANVSGEDINKSRGEVIANGSTKPNP |
Sequence similarities
Belongs to the disproportionating enzyme family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length955
- Mass (Da)109,777
- Last updated2002-06-01 v1
- Checksum248BCED6B0CE79BC
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC002409 EMBL· GenBank· DDBJ | AAB86444.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002685 EMBL· GenBank· DDBJ | AEC09889.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY081315 EMBL· GenBank· DDBJ | AAL91204.1 EMBL· GenBank· DDBJ | mRNA | ||
BT010364 EMBL· GenBank· DDBJ | AAQ56807.1 EMBL· GenBank· DDBJ | mRNA |